SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077XVR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XVR5
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000314
Family Anti-sigma factor antagonist SpoIIaa 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077XVR5
Sequence length 126
Comment (tr|A0A077XVR5|A0A077XVR5_9SPHI) Putative anti-anti-sigma regulatory factor (Antagonist of anti-sigma factor) {ECO:0000313|EMBL:CDT15964.1} OX=403776 OS=Sphingobacterium sp. PM2-P1-29. GN=BN1088_1500015 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MKYTIDKHDRYIVIEPLCDNLDAEKAVKLKGEFLLRNTVGQRNIILDLSNVRKIDESSIR
LALLANRLCDSSGGLFILANLDSEVLDVLEMTHLQTRFIIVNSVKDAEDRVFAHELELDY
RGEKEK
Download sequence
Identical sequences A0A077XVR5 A0A1R4JDG9
WP_045755770.1.65210 WP_045755770.1.70333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]