SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077XZF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XZF3
Domain Number 1 Region: 387-463
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077XZF3
Sequence length 484
Comment (tr|A0A077XZF3|A0A077XZF3_9SPHI) Putative sulfate transporter YbaR {ECO:0000313|EMBL:CDT31881.1} OX=403776 OS=Sphingobacterium sp. PM2-P1-29. GN=BN1088_800002 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MTMIPESLSFAILAGLSPLTGLYAAFLMGIVTAFLGGRPGMVSGGAGATVVVLIALASAH
GVEYLFAAVALAGIIQLLVGMLKLGKFVRLIPQPVMYGFLNGLAVIIFMAQVAQFKVLEN
GVSSWMEGSALAIMAGLTMLTIAIVLIFPKITKAIPSSLVAIIVVFGLVYFLNIDTKKVI
DIASVSGSLPSFHIPNIPFTIETLKIIFPYAAIMAGVGLIESLLTLNMVDEITNTKGRSN
KEACAQGIANITNGFFGGMGGCAMVAQTLVNIDAGARTRISAIIGAVTILIIILAGGPII
EQIPMAALVGVMMMVAIGTFEWVSFRIITKMPKSDIFVGMLVAIITVLLHNLALAVLIGV
IISALVFAWDNAKRIRAKKSIDEMGNKVYEIYGPLFFGSTTAFAEKFDAQGDPEKIIIDF
KESRIVDMSAIEALKKVTEKYTANNKEVVLKHLSPDCIQLLDNASGFIEVNLHEDPTYKV
MPEK
Download sequence
Identical sequences A0A077XZF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]