SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077Z0P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077Z0P7
Domain Number 1 Region: 161-211
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000305
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 2 Region: 58-113
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000025
Family Ovomucoid domain III-like 0.0049
Further Details:      
 
Domain Number 3 Region: 111-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000374
Family Ovomucoid domain III-like 0.028
Further Details:      
 
Domain Number 4 Region: 212-263
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000194
Family Ovomucoid domain III-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077Z0P7
Sequence length 271
Comment (tr|A0A077Z0P7|A0A077Z0P7_TRITR) Kazal type serine protease inhibitor {ECO:0000313|EMBL:CDW53616.1} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000188101 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MGDMRCRLLHFASARLKISLFVVLSLPVSLALLFPPGMDYLQSTNYWGGDVFWDQTNSEV
LTPKKELFCQCTSEYKPVCASMGKQSLTYDNLCLLSCSQRNISDLLYGYEGPCCRKLRCS
RGEKPFCDSKGNIYRNRCSFQFHQCEEWKKRKRVLKIGTACPCSNDCPNVFSPVCDTIGN
TYKNRCYFVREQCYFKKAYGKTLHFHHHGRCCSNQCRRHEYLEGPLCDSAGRTHKNLCAY
RLFSCLARKNGRLPSRIVYLGSCRLPVTSDR
Download sequence
Identical sequences A0A077Z0P7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]