SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077ZLP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077ZLP8
Domain Number 1 Region: 805-1053
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.2e-71
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000023
Further Details:      
 
Domain Number 2 Region: 143-376
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.83e-65
Family N-terminal domain of adrenodoxin reductase-like 0.0018
Further Details:      
 
Domain Number 3 Region: 451-645
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.18e-45
Family PFOR Pyr module 0.00000033
Further Details:      
 
Domain Number 4 Region: 647-802
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.43e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000505
Further Details:      
 
Domain Number 5 Region: 10-151
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.88e-31
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077ZLP8
Sequence length 1125
Comment (tr|A0A077ZLP8|A0A077ZLP8_TRITR) Fer4 20 and EKR and Pyr redox 2 and POR and POR N and Pyr redox domain containing protein {ECO:0000313|EMBL:CDW59575.1} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000791201 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MAKRSYTKTPMKEQAPEIRNQNFDEVALGYTLEEGQLEASRCLQCKNAPCITGCPVMIDI
PGFIKAIEEGNMPLAYEILGRYTNLPAICGRVCPQEKQCEMVCRLGRSKKFEPVAIGKLE
RLVADWALEQPLEYKEVNSDKGRVAVIGSGPSGLTTAGDLAKLGYDVTVYEALHAPGGVL
TYGIPEFRLPKRIVKQEIERIVAQGVKIETNVVVGKTITMDEIIDEFDACYLSVGAGAPR
FQGIKGTSLNGVYSSSEYLTRVNLMHGYQFPEYDTPVQKSKNVVVIGGGNVAMDAARSAK
RLGADKVSIVYRRSLEELPAREEEYHHSVEEGIEYHWLSNPIEYIDDGNGRLKAVKCVQM
DEFIIEADTAIEAIGQGANKVLLDTFPELSLNKWGYIDADEETCATSIPGVFAGGDIVTG
AATVILAMGAGKIAANEIDQYIQKTKQEQLWAEQGRKNIFNETVKVVEMQSEAGAAGTVH
GSLKTGVLTTTYTASQGLLLMIPNMFKIAGELLPTVFHVAARAVSTNALSIFGDHIMDLS
AVAHLASIEGRLPFMNFFDGFRTSHELQKIEVIDYDDLKAMMNWEALANFRRLGMNPNRP
NVSGTAQNPDIHFQQRETVNRYYDEMPAIVQKYMNKINNLRGTNYDLTNYYGDPEATEVI
IAMGSASPTIQQTVDYLNANGRKVGFLDIHLYRPFPAENLLEKLPDTVEKVAVLDRTKEP
GSDGEPLLLDVQSVLYRHTNRPIVIGGRYGIASKDVTPDQIVAVFNHLLFPAAELKQRFT
IGIIDDVTNLSLPMSEVLDLTPKSTFQAKFWGLGSDGTVGANKQAIKIIGNNTDYYAQAY
FSYDSKKSGGLTNSHLRFGKEPILSTYNVEAADFVGCHNSAYIHQYDLLKGLKDGGTFLL
NTVWDEEKVKQLLPNRLKRYLADHKINFYIINAMDIAQKTGLGGRINQVMSTAFFELTDI
MDHETYLPLLKAEVDAAYGKKSRTIVERNWQAIDATVAKLKKIEIPAEWAEVEAKALFSG
GDDTKPAYIRNILEPVNRQEGNQLSVNDLIENGMLGGVMPSGTAAYEKRGIALEVPEWIP
EHVQCVMNAPLSVPMRQFGHFLLMMRKWQQLLKASLPVICAEKTA
Download sequence
Identical sequences A0A077ZLP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]