SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A078A8I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078A8I0
Domain Number 1 Region: 581-764
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.27e-18
Family IP3 receptor type 1 binding core, domain 2 0.0018
Further Details:      
 
Domain Number 2 Region: 1387-1476
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000000536
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 3 Region: 310-498
Classification Level Classification E-value
Superfamily MIR domain 0.000000027
Family MIR domain 0.0078
Further Details:      
 
Domain Number 4 Region: 157-336
Classification Level Classification E-value
Superfamily MIR domain 0.000000401
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078A8I0
Sequence length 2894
Comment (tr|A0A078A8I0|A0A078A8I0_STYLE) Cation channel family protein {ECO:0000313|EMBL:CDW78570.1} KW=Complete proteome; Reference proteome OX=5949 OS=Stylonychia lemnae (Ciliate). GN=STYLEM_7550 OC=Stylonychia.
Sequence
MDNSYIKYGDKVVLYVETVQGFVQSQGFTNPNCYVQKSNYENEVFVRNYRDFVFQICPKL
NYDARKDYNQASRFFSKNSGGGGGQGSGSPRGGNKQQHTTRGDSKGGAQKKRYSTISQFT
RQNGLEEQTFKKKMQQLQKKLQEEEEMNQKVLERRKGEIVTYGQEIQLLHDDSQTFITAK
KMCAEIDKSCNKVELSDHGSSSIYFKVMPRYKYRQEGEKILFGDQVVLQNQKLNLYLHIT
EQILHIEKPLELPELPENIQKQICPQENDRRTPPNQYCPLFELNISTQLSRFQILPFANF
DEQDPQIIRGGSVVKFQHSELGGYLASDDKDFTNDGMAEVFLWTYKGKQLDVENFNTSSL
FELEIAGCENNKGKVGVESIPDDDGEEMLFRIRHLNSGRLVSAQEIMFEGQKLLTLGLSE
HLELKRLEKGEKTEASNTRHRFQEYQLEDEDKKEELIENTLFRMTSTNAEEDKTLQNNVC
VKIQHVKTGKYLSVKKKSFFVHANKSNSKTQATSGSGIVGGDKTERDKNEGEDENIGFGN
QLYQPIEDLEITQAYRNVVELKQVAGHTDAFFIQLESLDSLQDILFVHSSLGILKSAVPF
LCRQGHEIPKEIYAQVEKILTNLNRFVKGKEDGGESKMEQRQESSATQQTFSQGSEEDLT
TIRQRIFKRQKIVRELYLVELLVQILFYPFHTGAYDLEKITQEDQITKLCSLAYVLLKNA
VGGYEINEMYASQWINLFFMQAMKTNNLNDIQAQTTVNELVSDNRKLLEVQINPKIISQF
ISLCKSQERHKRLIKLLTALCTCNGMPIVRNQNDVVRYLLMDQDTKETLMMPIRLKDTEV
EIQLRSGTFIPIRELREISYSKDNGRIYKYFLSIVELAADLVQGRNMRAVTQLQQVFNLD
SSIKIIYDKELPFDMRSYFIELFLNMYIDKEPLEPLQIPALTMIQSEIPNLQTLINQNDK
GYLIQQAKCQIPQNLLQFKDFVLNYLKEENGVQSVFEKKKNQFIFWVLKSLYFMLSHGFY
KDQQELNELSYPLILLLDGSNDIYTDENNYSQAVNQIDQAATQERYKFSKENEIILKSKK
IQCDCLIFISQLELDGKTELFLSKLKYDMELVKKNDEVSGGFGRAILGKLFNNSFARKDS
NKSPEKKSNSSMLNDSKEIGQNNISLGQSSVFIGKLRQALNSDNPIDLKRLLQFQSNNEF
LNNIANIRGFEEQIEDIYICMLFDLLLYKYPELNQAAFELLVRYFTRRRTMLEALNNVQI
LEQKTSIDVLNKVKIYQSELKMYIQEADDWMNKKEKVATENKLRVSEIFKYVTHYCVNNN
GIILHSGRKPRVQLAKWLMDKSQNNMLSGLISNSTVMKDTAEEEQDAEDKQLMENEEYIM
FMEFKNSENKENQRIMRNFQMQELAIFFIQYRMEQSASQNQDYIKLIKQCYRFLIRFVRQ
NLANQTTLRDNLDVFLKDIEKFTLASLLIYEIFRDNKRLLNLVQIFIQFILFYQNVSKIL
KTIVAASEEADINSTKKATLLKLLTVFCRFKDKLVRQNQQDIIIFMTNNVARSSILYLFS
NEGFSEMNTLINSSKDIEILENYINGSYVTGPTMIVTTPIFNIIKCIELLSICCEGKSDV
AELKCQTDVLPIESAYKILESCEYFWPLKHTTTQYITQCFLDSQNKLVLAEDDEAGLRFL
WKSAEVIVNDLINIVENTQTEDEVFVKYPSGEVITLKQLSFQFLGKAVIPFFKALLKKRT
IKIDSYEKLLAAMAKYIAKLYYISNQYYDVKKDAYYLLKFIHESARYSRYIESVKHPFIG
QAEHNTIEDQDQEDRKKEADQTVENSKSSSLTTKIVQLTQSKDIKDQIEKEFEELVVWVC
NIEKKIRQVTRNQNQRGEQQYNLKSFENLTFQSVVCAILNLIDSKDLSKDLHISGLRLIR
KIIEVENEDLVTPAADWDTDDWIEFKSAIKMKQDALVEIGTIRFICKHISEVDDDDILEQ
ALLAGIAILLGGNQKSQEAFLQYMQDNDPHNRVILKIKNMLVKQFDNTKNYLSEKIAKLI
MVSKLQDKALKKQRTIQDKIQKSIASALISREKIPEEAKIHDTSQENLMTLEDSFQNHED
DSKKKENNETYADETSQVNQNKQQSINKLMRILRFLQLLTENHFTPMQDFLREQATSAGQ
TNSKTFDIVSYISTMLGNYENQYVNCYSCYLGYQMIETLTEFVQGPCKENQRALVNAKVI
DNCRDMISQGTQSERELKEKGFTGEKIKLLDGLKMKAVRLLLSIIEGPIDQEIIRNITIS
LDDFEIIFERLNTVFNAFVENELSISTSSSLATVQSALRKDSFDGDVQEGFDIFILINSL
ADCYPEAKKKIESFEENNYYQFFKYNTGQIEILLDGEQLQRVYFPLKPVCRFLSEQSRKA
LMLNVDRTSPQQKILGLLKSVPDLIDEMEHVEVLSRQKIQVTPDRLNFLRDCSTLLAVGI
SIIIIGYYKYDSITYSDGSLDVGPTIDPTPGLAILIMGYIQLGTAACLLIGWVINKAALI
IKAGWRVYTEENRIKYQGVLQKKKEEDQGSFNLKKADEMSLLDARLILITQGPLAEEFID
DGELKLGHFILKLEYLWISASFVIGNGSFKFFVIYLALSLLGLYQSPIFYSFQLLDIINR
FSTLRNVIAAITTNKNQLLMTAMLGIIIIYIYSVLGYAFFFDMYYNEDINLEEWIGEKGD
MTCQSLFHCFISTINYGLRAGGGIGEALPALSYLNSTTEEFYLRVVFDLSFFLIVIIMFL
NIIFGIIIDTFAELRENKRFIDDDMKNTCFICNIDRQTFDRDSEHGFMHHIANEHNLWQY
VFFIIHLKTKDKTDYNGTESFIHYKLLEEDISWFPLHTSIALEKDKYVISDSNDKAATAP
QPEDKEKEGGDEKS
Download sequence
Identical sequences A0A078A8I0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]