SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A078B2F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078B2F3
Domain Number 1 Region: 318-482
Classification Level Classification E-value
Superfamily EF-hand 1.01e-26
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 2 Region: 135-246
Classification Level Classification E-value
Superfamily MIR domain 0.00000602
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078B2F3
Sequence length 485
Comment (tr|A0A078B2F3|A0A078B2F3_STYLE) Ef hand family protein {ECO:0000313|EMBL:CDW88411.1} KW=Complete proteome; Reference proteome OX=5949 OS=Stylonychia lemnae (Ciliate). GN=STYLEM_17532 OC=Stylonychia.
Sequence
MYFTPQQLSGGPRFNHKTRVGNWQEDWESNETKLKEYMKKKETNQLVINQTQQKYAKSLQ
RVPQTYTHDGRLRFGDSIMLLNKMTSGYLAFDMSDKIPAHEEAYSCTTTDKVGPCARSVF
VLSKGEDDGAPDNIIRYGQKVKFESNPHIYAKKLYLHSTMISPQFFARFSRNQEVCMTAK
NIYNTVFKILHIDPNLRNTSLGDAVGANEQVLIEHCATSQYLASDKINYRNDFGMEYEVC
VNSYATNNKSQALNLERVGKLTVEQPTKIQLDQNVWVIATASDPSLAEPIKEPPKYTAQD
LLNDIKQKLQARGTLGIRGLGRMFRILDNNGNRNLDIKELQYGLGDFGVYIDDEQASVIL
AHFDRDRNGVVNYDEFLRAIRGDLNEYRLGLIKKAYQKLDENSDGTVKLDDIAKLYDVSK
HPDIVGGRKQPQQVYMEFMKLWETQVADGIVTFDEFCDYFRDVSASVDRDDYFALMMQNS
WKIQV
Download sequence
Identical sequences A0A078B2F3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]