SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A078BMX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078BMX2
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000116
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078BMX2
Sequence length 96
Comment (tr|A0A078BMX2|A0A078BMX2_9BURK) Sulfate transporter/antisigma-factor antagonist STAS {ECO:0000313|EMBL:CDW94691.1} OX=554131 OS=Thiomonas sp. CB2. GN=THICB2_560054 OC=Thiomonas.
Sequence
MPVYALPADLTLDTASAVRRQALATLGEASGAQSTPWVVDAGALHTFDSAALALLLELRR
VAPQQALEVKAIPARLRDLAKAYGLEFLFGPAAEHP
Download sequence
Identical sequences A0A078BMX2 A0A1D2USW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]