SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078F7V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078F7V0
Domain Number 1 Region: 63-143
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.24e-19
Family Skp1 dimerisation domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A078F7V0
Sequence length 154
Comment (tr|A0A078F7V0|A0A078F7V0_BRANA) BnaC03g48190D protein {ECO:0000313|EMBL:CDY07803.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00124944001 OC=Brassica.
Sequence
MSSVYARKPKTSWRKDNRWKRMHHSRRRKAPVATAKWKRRMKAWDEANASDKDIYGNTED
AELKNWDTEFVQVNQPMLFDLILVSIQLGHPIMAAKYLNITGLLDLTCRTVAYMIIDKIP
EDMCTNIKNDYTPEEETEVRKEHGPSSDFWSLVV
Download sequence
Identical sequences A0A078F7V0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]