SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A078HD57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078HD57
Domain Number 1 Region: 33-208
Classification Level Classification E-value
Superfamily MIR domain 6.15e-56
Family MIR domain 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A078HD57
Sequence length 218
Comment (tr|A0A078HD57|A0A078HD57_BRANA) BnaA04g14730D protein {ECO:0000313|EMBL:CDY35374.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00058351001 OC=Brassica.
Sequence
MALGFFCLALFLYLSLDPDSGYTSASAAPSGKEGVEITYGSAIKLMHEKTKFRLHSHDVP
YGSGSGQQSVTGFPGVTDSNSYWIVKPVPGTAFKQGDAIKNGATIRLQHMKTRKWLHSHL
HASPISGNLEVSCFGDDSNSDTGDHWKLTIEGSGKIWKQDQRVRLQHIDTSGYLHSHDKK
YQRIAGGQQEVCGIREKRADNVWLAAEGVYLPVNESSK
Download sequence
Identical sequences A0A078HD57 M4ETA8
Bra032038 XP_009140621.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]