SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078HFV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078HFV5
Domain Number 1 Region: 47-182
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.24e-39
Family Insert subdomain of RNA polymerase alpha subunit 0.0000434
Further Details:      
 
Domain Number 2 Region: 11-52,213-301
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 8.05e-34
Family RNA polymerase alpha subunit dimerisation domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078HFV5
Sequence length 319
Comment (tr|A0A078HFV5|A0A078HFV5_BRANA) BnaA07g04260D protein {ECO:0000313|EMBL:CDY36631.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00062367001 OC=Brassica.
Sequence
MDSGATYQRFPKVKIRELKDDYAKFELRDTDVSMANALRRVMISEVPTVAIDLVEIEVNS
SVLNDEFIAHRLGLIPLTSERAMSMRFSRDCDACDGDGQCEFCSVEFRLSAKCVTDQTLD
VTSKDLYSADPTVTPVDFGDSSGADSSEQRGIIIVKLRRGQELKLRAIARKGIGKDHAKW
SPAATVTFMYEPDIIINEDMMDTLTDDEKIDLIESSPTKVFDFDAVTRQVVVVDPEAYTY
DEEVIKKAEAMGKQGLIEIRPKDDSFIFTVESTGAVKASQLVLNAIDLLKQKLDAVRLSD
DTVEADDQFGELGAHMRGG
Download sequence
Identical sequences A0A078HFV5 A0A0D3D418 M4DFE5
Bra015218 XP_009119413.1.100322 XP_013592961.1.26608 XP_013667076.1.73403 XP_013742691.1.73403 XP_013742692.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]