SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078IN65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078IN65
Domain Number 1 Region: 29-173
Classification Level Classification E-value
Superfamily NAP-like 4.97e-38
Family NAP-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078IN65
Sequence length 188
Comment (tr|A0A078IN65|A0A078IN65_BRANA) BnaA10g29000D protein {ECO:0000313|EMBL:CDY50473.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00096778001 OC=Brassica.
Sequence
MSSDKDSFNVGDLTTGLKDEDRAGLVNALKNKLQNLAGQHSDVLENLTPKIRRRVEVLRE
IQGKHDEIEDNFREERAALEAKYQKLYQPLYTKIVNGAIEVEGAQEDVKMDQREEKTAEE
KGVPSFWLTALKNNDVISEEITERDEGALMYLKDIKWCKIEEPKGFKLEFFFDQIYILCC
NLKKIFSL
Download sequence
Identical sequences A0A078IN65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]