SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078J9X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078J9X9
Domain Number 1 Region: 63-156
Classification Level Classification E-value
Superfamily DNA-binding domain 8.83e-25
Family Methyl-CpG-binding domain, MBD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078J9X9
Sequence length 216
Comment (tr|A0A078J9X9|A0A078J9X9_BRANA) BnaCnng43280D protein {ECO:0000313|EMBL:CDY64150.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00040925001 OC=Brassica.
Sequence
MAEEENGIVAKPRAKKEIAPGRLIDTYAAQCENCHQWRVIDGQEEYEDIRSRMIDDPFTC
DKKQISCEDPADLDYDSSRTWVIDKPGLPKTPKGFKRSLVLRKDYSKMDTYYFTPTGKKL
RSRNEVASYVEANPEFKGAPLEDFSFTVPKVMEDTAPPDPKVAASPVAKVASPVVAAATP
SDDDVSDKSAKSKEFKGKFKLEEDTLSGTPHVSPAP
Download sequence
Identical sequences A0A078J9X9 A0A0D3DV84
XP_013602084.1.26608 XP_013712391.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]