SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A078KBF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078KBF3
Domain Number 1 Region: 60-163
Classification Level Classification E-value
Superfamily MIR domain 0.0000994
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078KBF3
Sequence length 296
Comment (tr|A0A078KBF3|A0A078KBF3_9APIC) YIR protein {ECO:0000313|EMBL:CDZ12987.1} KW=Complete proteome OX=5861 OS=Plasmodium yoelii. GN=PY17X_1100900 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MNDDLCRKFVFLRTYLPDDLSVNGTLELKDHKNFKNYCPVTESGENECNNNLGKITAGFL
WLLEQCYSISINSSYNENNTNLFFIYMISWFSYQLNKIKGHDSTKIKDFYTKYVINSHKY
DNFKNTAYKFTKIEEFIDKKNDLLNINIQDLSKFYDAFKLLCSMYGDISTNTDVKKLSDD
ANEFVKKYQELKGYSNHTDGNSYKQILSALLTDYDNLKNISTNITPLPEITANVSALSSG
DTSSTGNKLFTVLSIFGAIAFFLGISYKYSLFGFRKRAQKQYLREKIKNIKKRMNS
Download sequence
Identical sequences A0A078KBF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]