SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A078L2J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078L2J5
Domain Number 1 Region: 470-566
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000106
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078L2J5
Sequence length 624
Comment (tr|A0A078L2J5|A0A078L2J5_9CHLA) Putative sulfate transporterc/MT1781 {ECO:0000313|EMBL:CDZ80860.1} KW=Complete proteome; Reference proteome OX=1444712 OS=Candidatus Rubidus massiliensis. GN=BN1013_01383 OC=Bacteria; Chlamydiae; Chlamydiales; Chlamydiaceae; Candidatus Rubidus.
Sequence
MALHYHQDDISLSSLRQDLKNYSLQTFQADATAALSVALLTIPQALAYAVLAGLPLYCGL
FAAIYASMVAAFFGSSRHLIVGPSNAIAILVQAGTSEILFNFYRDATGPEREALAVQILA
SLSFLSAVIQMLAASFKLGRLVQFVSYSVIIGYMAGSAVAVFVNQLYTFLGLNRMPGVHS
LYQDIFYIITHVYKLHWPSTLIGLITLCSIVLFKRIDKRIPAAIAALAFSSILVYIIDYS
NGLWNGISDSVDLYHTVPLVGDTGDFSTLWPNIAWPSFESGVLNALLPFAFAVALLSIME
TTTVSKSVAASSGQHLSVNQEILGVGLGNLVAAFISAMPISGSASRTVLSYSQGAQTRFA
SILNAVIVASFLYLFSYSAGRIPLTALAALLLFTSINIVNFKQLSICNKATRSDAFVLWT
TFFSCIFLSLDLAFYIGVILSIVLYLKKAAIPQLVEYDVEESGELRNPIHHNEHRNIRII
KVEGELFFGAADLFQTTLKTLTEDDTHTKVIVLQLKNARDIDATSCLALQQLFEYLRNSH
RYLLACGITQPIWDVLSDSGLVEIIGKENLYIFDEKHPHYHMQKALMRARFLATSPEPKP
LPKVEEAAKLEEILIPPTAESDTV
Download sequence
Identical sequences A0A078L2J5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]