SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078LQ90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078LQ90
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.75e-44
Family N-terminal domain of MutM-like DNA repair proteins 0.000000502
Further Details:      
 
Domain Number 2 Region: 130-222
Classification Level Classification E-value
Superfamily S13-like H2TH domain 8.64e-31
Family Middle domain of MutM-like DNA repair proteins 0.000012
Further Details:      
 
Domain Number 3 Region: 217-269
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078LQ90
Sequence length 269
Comment (tr|A0A078LQ90|A0A078LQ90_CITKO) DNA-(apurinic or apyrimidinic site) lyase MutM {ECO:0000256|HAMAP-Rule:MF_00103} KW=Complete proteome OX=545 OS=Citrobacter koseri (Citrobacter diversus). GN=BN1086_04707 OC=Enterobacteriaceae; Citrobacter.
Sequence
MPELPEVETSRRGIEPHLVGATILHANVRNGRLRWPVSEEIYRLSDKPVLSVQRRAKYLL
LELPDGWIIIHLGMSGSLRILPEELPAEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKEL
EGHNVLAHLGPEPLSDDFNGAYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSQAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVAAKHAQRATFYCRQCQK
Download sequence
Identical sequences A0A078LQ90 A0A1F2JLY6
WP_047460253.1.29396 WP_047460253.1.62044 WP_047460253.1.6732 WP_047460253.1.67650 WP_047460253.1.82876 WP_047460253.1.8528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]