SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A078M6S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078M6S8
Domain Number 1 Region: 466-551
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A078M6S8
Sequence length 576
Comment (tr|A0A078M6S8|A0A078M6S8_9PSED) Sulfate transporter {ECO:0000313|EMBL:CEA00376.1} OX=1461581 OS=Pseudomonas saudimassiliensis. GN=BN1049_00037 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MPNHSFKLPLFVALRESFRQGYSFARLRGDVLAGITVGIIAIPLAMALAIAVGVAPQHGL
YTGIVGGLLIALCGGSRFNISGPTAAFVVILLPITQQHGLGGLLLVTLMAGMILLMLGLA
RLGNLIQFVPYPVVMGFTAGIGIVIATLQIKDFFGLQLAAQPSHYLEQWQLLISALPSIQ
MGDTLVGVATLSVLLLWPKLTRRIPGHLIALLAGSLLGALLLAMDIPVATLGARFSYELD
GVTHAGIPPFAPQWVLPWQLPGADGEPLTVNFALLQQLLPSALAVAMLGAIESLLCALVA
DGMANTRHDPNAELLGQGLGNLIVPFFGGITATAAIARTATSVRSGAFSPIAAVVHALVI
LLAVVLLARLFAWLPMASLAAMLLIVAWNMSEAPQVLHLLRVGPRQDVLVLLICLLLTVL
FDMVLAVGVGLLLAAALFIKRMADLSEGGAQPRAQDQALADLPDCVALYRIHGPLFFAAA
DKALDAINRFDGQTRYVVLDMRSVPSMDMSALVLFEKALRGLAERGMQVYLVGVRAPIRL
KLKRAGISASRDRRTFAGTPQRAAQMIRAKLAATAD
Download sequence
Identical sequences A0A078M6S8
WP_044497589.1.73574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]