SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078MGV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078MGV9
Domain Number 1 Region: 53-177
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.71e-45
Family Insert subdomain of RNA polymerase alpha subunit 0.0000102
Further Details:      
 
Domain Number 2 Region: 7-53,178-232
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.86e-30
Family RNA polymerase alpha subunit dimerisation domain 0.0000866
Further Details:      
 
Domain Number 3 Region: 250-323
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 8.89e-26
Family C-terminal domain of RNA polymerase alpha subunit 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A078MGV9
Sequence length 333
Comment (tr|A0A078MGV9|A0A078MGV9_9PSED) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} OX=1461581 OS=Pseudomonas saudimassiliensis. GN=BN1049_02951 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQNSVAEFLTPRHIDVQETSSTRAKITLEPLERGFGHTLGNALRRILLSSMPGCAVVEAE
IDGVLHEYSAIEGVQEDVIEILLNLKGVAIKMHGRDHVTLTLSKKGPGVVTAGDIQLDHD
VEIINPDHHIATLSDNGALNMKLTIARGRGYEPADSRQSDEDESRSIGRLQLDATYTPVR
RVAYVVESARVEQRTNLDKLVIDLETNGTLDPEEAIRRAATILQHQLAAFVDLKGDQEPV
VEQQEDEIDPILLRPVDDLELTVRSANCLKAENIYYIGDLIQRTEVELLKTPNLGKKSLT
EIKDVLASRGLSLGMRLDNWPPASLKKDDKVTA
Download sequence
Identical sequences A0A078MGV9
WP_044501150.1.73574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]