SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A078S5C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078S5C9
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.53e-21
Family Anti-sigma factor antagonist SpoIIaa 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A078S5C9
Sequence length 103
Comment (tr|A0A078S5C9|A0A078S5C9_9BACT) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=1339344 OS=Parabacteroides distasonis str. 3999B T(B) 4. GN=M095_4865 OC=Parabacteroides.
Sequence
MEVVIDQKGEETVIKIKGRLDTNTARECEEKVLPVWENPGVKVCVDCSDLEYVSSAGLRL
FLILQKMTTAKKGSLRLIGMRNVVRETFSLTGFNALFKIEDAK
Download sequence
Identical sequences A0A073I637 A0A078S5C9 A0A0J9D8L6 A0A174L936 A0A1Q6FC50 A0A223HHY5 A6LHU4 C7X5N2 D7IMF2 E1YPM3 K6A1J8 K6BHB0
WP_005859339.1.12386 WP_005859339.1.29417 WP_005859339.1.38556 WP_005859339.1.40665 WP_005859339.1.47855 WP_005859339.1.56575 WP_005859339.1.61673 WP_005859339.1.72038 WP_005859339.1.725 WP_005859339.1.76859 WP_005859339.1.86952 WP_005859339.1.87144 WP_005859339.1.88644 WP_005859339.1.98975 WP_005859339.1.99689 gi|150010137|ref|YP_001304880.1| 435591.BDI_3560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]