SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A080FXH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080FXH4
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.63e-75
Family Methylesterase CheB, C-terminal domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.01e-27
Family CheY-related 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A080FXH4
Sequence length 349
Comment (tr|A0A080FXH4|A0A080FXH4_ECOLX) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1444275 OS=Escherichia coli 1-392-07_S4_C3. GN=AD40_2248 OC=Enterobacteriaceae; Escherichia.
Sequence
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELSRSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
Download sequence
Identical sequences A0A027TSP1 A0A028ATR3 A0A028E3R1 A0A066REE0 A0A070EV29 A0A073FWX3 A0A074HXP6 A0A080FXH4 A0A0A8UF99 A0A0E0XZE1 A0A0E2U502 A0A1S6TBX9 A0A1X3IZK6 A0A1X3L2D0 A0A222QM17 A0A236WXM7 A7ZN10 B6I0T5 C8U3H4 C8UC60 D7Y1D4 E0J574 E1ISR9 E9THT0 F4NEW2 F4VGD8 I0VLP1 I2SPI3 I2US87 I2W492 K4VSF1 K4WKV3 L2XLT0 M9H680 S0VHE1 T5TC21 U9XXI6 V2TEE8 V6FQZ5 V8FNB4 W1EUA4
gi|260868481|ref|YP_003234883.1| gi|378712673|ref|YP_005277566.1| gi|386709745|ref|YP_006173466.1| gi|260855823|ref|YP_003229714.1| gi|410482133|ref|YP_006769679.1| gi|378712673|ref|YP_005277566.1| gi|386709745|ref|YP_006173466.1| gi|209919309|ref|YP_002293393.1| gi|544390522|ref|YP_008565061.1| gi|260844293|ref|YP_003222071.1| 331111.EcE24377A_2116 409438.ECSE_2118 573235.ECO26_2735 585034.ECIAI1_1970 585395.ECO103_2145 585396.ECO111_2469 gi|157157545|ref|YP_001463189.1| WP_000036378.1.1000 WP_000036378.1.100066 WP_000036378.1.100185 WP_000036378.1.100252 WP_000036378.1.100283 WP_000036378.1.100346 WP_000036378.1.100425 WP_000036378.1.100499 WP_000036378.1.100543 WP_000036378.1.100571 WP_000036378.1.100573 WP_000036378.1.10067 WP_000036378.1.10068 WP_000036378.1.100689 WP_000036378.1.100718 WP_000036378.1.100752 WP_000036378.1.100778 WP_000036378.1.100796 WP_000036378.1.10080 WP_000036378.1.100836 WP_000036378.1.10086 WP_000036378.1.100928 WP_000036378.1.100933 WP_000036378.1.100990 WP_000036378.1.101096 WP_000036378.1.101102 WP_000036378.1.101157 WP_000036378.1.101158 WP_000036378.1.101216 WP_000036378.1.101255 WP_000036378.1.101257 WP_000036378.1.10126 WP_000036378.1.101289 WP_000036378.1.101293 WP_000036378.1.101359 WP_000036378.1.101418 WP_000036378.1.101436 WP_000036378.1.101468 WP_000036378.1.101518 WP_000036378.1.10154 WP_000036378.1.101583 WP_000036378.1.101630 WP_000036378.1.101651 WP_000036378.1.101653 WP_000036378.1.101668 WP_000036378.1.101686 WP_000036378.1.10173 WP_000036378.1.101786 WP_000036378.1.101822 WP_000036378.1.10184 WP_000036378.1.101840 WP_000036378.1.101845 WP_000036378.1.101865 WP_000036378.1.10187 WP_000036378.1.10190 WP_000036378.1.101908 WP_000036378.1.101913 WP_000036378.1.101947 WP_000036378.1.101952 WP_000036378.1.101969 WP_000036378.1.101987 WP_000036378.1.102069 WP_000036378.1.102122 WP_000036378.1.10379 WP_000036378.1.10400 WP_000036378.1.10461 WP_000036378.1.10538 WP_000036378.1.10579 WP_000036378.1.10607 WP_000036378.1.10651 WP_000036378.1.10673 WP_000036378.1.10729 WP_000036378.1.1073 WP_000036378.1.1074 WP_000036378.1.10763 WP_000036378.1.10798 WP_000036378.1.10922 WP_000036378.1.10940 WP_000036378.1.10989 WP_000036378.1.11006 WP_000036378.1.11032 WP_000036378.1.11071 WP_000036378.1.11121 WP_000036378.1.11133 WP_000036378.1.112 WP_000036378.1.1122 WP_000036378.1.11524 WP_000036378.1.11578 WP_000036378.1.11616 WP_000036378.1.11645 WP_000036378.1.1168 WP_000036378.1.11699 WP_000036378.1.11748 WP_000036378.1.11759 WP_000036378.1.1186 WP_000036378.1.11949 WP_000036378.1.11985 WP_000036378.1.12030 WP_000036378.1.12036 WP_000036378.1.12051 WP_000036378.1.12279 WP_000036378.1.12319 WP_000036378.1.12320 WP_000036378.1.12342 WP_000036378.1.12344 WP_000036378.1.1242 WP_000036378.1.12478 WP_000036378.1.12558 WP_000036378.1.12623 WP_000036378.1.12645 WP_000036378.1.12717 WP_000036378.1.12743 WP_000036378.1.12749 WP_000036378.1.12781 WP_000036378.1.12831 WP_000036378.1.12876 WP_000036378.1.12911 WP_000036378.1.1295 WP_000036378.1.12979 WP_000036378.1.1312 WP_000036378.1.1315 WP_000036378.1.13162 WP_000036378.1.13222 WP_000036378.1.13290 WP_000036378.1.13301 WP_000036378.1.1335 WP_000036378.1.13437 WP_000036378.1.13495 WP_000036378.1.13525 WP_000036378.1.13601 WP_000036378.1.13791 WP_000036378.1.13924 WP_000036378.1.13944 WP_000036378.1.14058 WP_000036378.1.14062 WP_000036378.1.14199 WP_000036378.1.14304 WP_000036378.1.1439 WP_000036378.1.14398 WP_000036378.1.14417 WP_000036378.1.14432 WP_000036378.1.14493 WP_000036378.1.14501 WP_000036378.1.14536 WP_000036378.1.14582 WP_000036378.1.14601 WP_000036378.1.14672 WP_000036378.1.14678 WP_000036378.1.14693 WP_000036378.1.14956 WP_000036378.1.14977 WP_000036378.1.14993 WP_000036378.1.15041 WP_000036378.1.15087 WP_000036378.1.15138 WP_000036378.1.15177 WP_000036378.1.15207 WP_000036378.1.1524 WP_000036378.1.15270 WP_000036378.1.15277 WP_000036378.1.15282 WP_000036378.1.15300 WP_000036378.1.15332 WP_000036378.1.15335 WP_000036378.1.15416 WP_000036378.1.1543 WP_000036378.1.15444 WP_000036378.1.15521 WP_000036378.1.15528 WP_000036378.1.15583 WP_000036378.1.15593 WP_000036378.1.15600 WP_000036378.1.1561 WP_000036378.1.15707 WP_000036378.1.15731 WP_000036378.1.15752 WP_000036378.1.15767 WP_000036378.1.15791 WP_000036378.1.15809 WP_000036378.1.15916 WP_000036378.1.15945 WP_000036378.1.15983 WP_000036378.1.16014 WP_000036378.1.16087 WP_000036378.1.16171 WP_000036378.1.16183 WP_000036378.1.16194 WP_000036378.1.1621 WP_000036378.1.163 WP_000036378.1.16387 WP_000036378.1.16388 WP_000036378.1.1640 WP_000036378.1.16517 WP_000036378.1.16592 WP_000036378.1.16648 WP_000036378.1.16682 WP_000036378.1.1673 WP_000036378.1.16745 WP_000036378.1.16805 WP_000036378.1.16861 WP_000036378.1.1710 WP_000036378.1.17109 WP_000036378.1.17111 WP_000036378.1.17170 WP_000036378.1.17172 WP_000036378.1.17182 WP_000036378.1.17241 WP_000036378.1.17242 WP_000036378.1.17267 WP_000036378.1.17297 WP_000036378.1.17356 WP_000036378.1.17373 WP_000036378.1.17392 WP_000036378.1.17403 WP_000036378.1.17410 WP_000036378.1.17417 WP_000036378.1.17464 WP_000036378.1.17550 WP_000036378.1.17595 WP_000036378.1.17623 WP_000036378.1.17637 WP_000036378.1.1766 WP_000036378.1.1769 WP_000036378.1.17766 WP_000036378.1.17802 WP_000036378.1.17829 WP_000036378.1.17963 WP_000036378.1.17984 WP_000036378.1.18006 WP_000036378.1.18094 WP_000036378.1.18164 WP_000036378.1.18175 WP_000036378.1.18226 WP_000036378.1.18338 WP_000036378.1.18410 WP_000036378.1.18436 WP_000036378.1.18438 WP_000036378.1.1844 WP_000036378.1.18458 WP_000036378.1.18482 WP_000036378.1.18530 WP_000036378.1.1866 WP_000036378.1.18666 WP_000036378.1.1867 WP_000036378.1.18714 WP_000036378.1.18861 WP_000036378.1.18874 WP_000036378.1.18923 WP_000036378.1.18983 WP_000036378.1.19090 WP_000036378.1.19147 WP_000036378.1.1925 WP_000036378.1.19277 WP_000036378.1.19297 WP_000036378.1.19312 WP_000036378.1.19314 WP_000036378.1.19332 WP_000036378.1.19389 WP_000036378.1.19397 WP_000036378.1.19424 WP_000036378.1.19448 WP_000036378.1.19494 WP_000036378.1.19544 WP_000036378.1.19557 WP_000036378.1.19581 WP_000036378.1.19583 WP_000036378.1.1963 WP_000036378.1.19778 WP_000036378.1.20129 WP_000036378.1.20157 WP_000036378.1.20159 WP_000036378.1.20183 WP_000036378.1.20215 WP_000036378.1.20251 WP_000036378.1.20325 WP_000036378.1.20334 WP_000036378.1.20483 WP_000036378.1.20493 WP_000036378.1.20519 WP_000036378.1.20662 WP_000036378.1.20730 WP_000036378.1.20785 WP_000036378.1.20824 WP_000036378.1.20848 WP_000036378.1.2094 WP_000036378.1.21041 WP_000036378.1.21104 WP_000036378.1.21137 WP_000036378.1.21320 WP_000036378.1.21336 WP_000036378.1.21441 WP_000036378.1.21519 WP_000036378.1.21628 WP_000036378.1.21667 WP_000036378.1.21696 WP_000036378.1.21732 WP_000036378.1.21812 WP_000036378.1.21948 WP_000036378.1.22138 WP_000036378.1.22204 WP_000036378.1.22269 WP_000036378.1.22291 WP_000036378.1.22350 WP_000036378.1.22544 WP_000036378.1.22599 WP_000036378.1.22631 WP_000036378.1.22685 WP_000036378.1.22777 WP_000036378.1.22783 WP_000036378.1.22868 WP_000036378.1.22878 WP_000036378.1.22908 WP_000036378.1.23005 WP_000036378.1.23026 WP_000036378.1.23035 WP_000036378.1.23078 WP_000036378.1.23092 WP_000036378.1.23135 WP_000036378.1.23290 WP_000036378.1.23376 WP_000036378.1.23378 WP_000036378.1.23388 WP_000036378.1.23393 WP_000036378.1.23487 WP_000036378.1.23527 WP_000036378.1.23593 WP_000036378.1.23640 WP_000036378.1.23693 WP_000036378.1.23741 WP_000036378.1.23754 WP_000036378.1.23915 WP_000036378.1.23950 WP_000036378.1.23953 WP_000036378.1.24024 WP_000036378.1.24068 WP_000036378.1.24124 WP_000036378.1.24278 WP_000036378.1.24374 WP_000036378.1.24381 WP_000036378.1.24383 WP_000036378.1.24460 WP_000036378.1.24473 WP_000036378.1.24483 WP_000036378.1.24485 WP_000036378.1.24575 WP_000036378.1.24642 WP_000036378.1.24646 WP_000036378.1.24650 WP_000036378.1.24695 WP_000036378.1.24758 WP_000036378.1.2479 WP_000036378.1.24849 WP_000036378.1.24876 WP_000036378.1.24929 WP_000036378.1.24939 WP_000036378.1.24946 WP_000036378.1.25019 WP_000036378.1.25039 WP_000036378.1.2504 WP_000036378.1.25050 WP_000036378.1.25086 WP_000036378.1.25378 WP_000036378.1.25414 WP_000036378.1.2543 WP_000036378.1.25548 WP_000036378.1.25592 WP_000036378.1.25613 WP_000036378.1.25631 WP_000036378.1.25726 WP_000036378.1.25755 WP_000036378.1.2588 WP_000036378.1.25886 WP_000036378.1.25945 WP_000036378.1.26055 WP_000036378.1.26061 WP_000036378.1.26100 WP_000036378.1.26130 WP_000036378.1.26161 WP_000036378.1.26186 WP_000036378.1.26191 WP_000036378.1.26270 WP_000036378.1.26325 WP_000036378.1.26331 WP_000036378.1.2637 WP_000036378.1.26391 WP_000036378.1.2642 WP_000036378.1.26479 WP_000036378.1.26569 WP_000036378.1.26598 WP_000036378.1.26613 WP_000036378.1.26658 WP_000036378.1.26683 WP_000036378.1.26716 WP_000036378.1.26720 WP_000036378.1.26912 WP_000036378.1.26941 WP_000036378.1.27019 WP_000036378.1.27060 WP_000036378.1.27141 WP_000036378.1.27148 WP_000036378.1.27234 WP_000036378.1.27260 WP_000036378.1.27287 WP_000036378.1.2731 WP_000036378.1.27310 WP_000036378.1.27330 WP_000036378.1.27424 WP_000036378.1.27524 WP_000036378.1.2755 WP_000036378.1.27691 WP_000036378.1.27723 WP_000036378.1.27749 WP_000036378.1.27856 WP_000036378.1.27876 WP_000036378.1.27897 WP_000036378.1.28109 WP_000036378.1.28110 WP_000036378.1.28250 WP_000036378.1.2826 WP_000036378.1.28305 WP_000036378.1.28371 WP_000036378.1.28523 WP_000036378.1.28540 WP_000036378.1.28554 WP_000036378.1.28683 WP_000036378.1.28760 WP_000036378.1.2881 WP_000036378.1.28919 WP_000036378.1.28953 WP_000036378.1.29001 WP_000036378.1.29013 WP_000036378.1.29082 WP_000036378.1.29100 WP_000036378.1.29118 WP_000036378.1.29125 WP_000036378.1.29150 WP_000036378.1.29176 WP_000036378.1.29206 WP_000036378.1.29495 WP_000036378.1.29503 WP_000036378.1.29504 WP_000036378.1.2954 WP_000036378.1.29590 WP_000036378.1.29669 WP_000036378.1.29683 WP_000036378.1.29715 WP_000036378.1.29724 WP_000036378.1.29798 WP_000036378.1.29812 WP_000036378.1.29821 WP_000036378.1.29840 WP_000036378.1.29874 WP_000036378.1.29876 WP_000036378.1.29884 WP_000036378.1.2995 WP_000036378.1.30035 WP_000036378.1.30105 WP_000036378.1.30123 WP_000036378.1.30391 WP_000036378.1.30399 WP_000036378.1.30428 WP_000036378.1.30452 WP_000036378.1.30497 WP_000036378.1.30554 WP_000036378.1.30733 WP_000036378.1.30742 WP_000036378.1.30762 WP_000036378.1.30783 WP_000036378.1.30853 WP_000036378.1.30906 WP_000036378.1.31009 WP_000036378.1.31089 WP_000036378.1.31295 WP_000036378.1.31319 WP_000036378.1.31340 WP_000036378.1.31347 WP_000036378.1.31357 WP_000036378.1.31419 WP_000036378.1.31429 WP_000036378.1.31518 WP_000036378.1.31521 WP_000036378.1.31618 WP_000036378.1.3169 WP_000036378.1.31709 WP_000036378.1.31835 WP_000036378.1.31860 WP_000036378.1.31866 WP_000036378.1.32020 WP_000036378.1.32037 WP_000036378.1.32089 WP_000036378.1.32091 WP_000036378.1.32142 WP_000036378.1.3215 WP_000036378.1.32184 WP_000036378.1.32232 WP_000036378.1.32234 WP_000036378.1.32236 WP_000036378.1.32287 WP_000036378.1.32406 WP_000036378.1.32443 WP_000036378.1.3247 WP_000036378.1.32475 WP_000036378.1.32494 WP_000036378.1.32561 WP_000036378.1.32655 WP_000036378.1.32680 WP_000036378.1.32709 WP_000036378.1.32724 WP_000036378.1.32831 WP_000036378.1.32875 WP_000036378.1.32910 WP_000036378.1.32946 WP_000036378.1.32959 WP_000036378.1.32972 WP_000036378.1.32992 WP_000036378.1.32995 WP_000036378.1.33018 WP_000036378.1.33341 WP_000036378.1.334 WP_000036378.1.33475 WP_000036378.1.33512 WP_000036378.1.3354 WP_000036378.1.33595 WP_000036378.1.33638 WP_000036378.1.33667 WP_000036378.1.33680 WP_000036378.1.33745 WP_000036378.1.34094 WP_000036378.1.3411 WP_000036378.1.34122 WP_000036378.1.34206 WP_000036378.1.34273 WP_000036378.1.34397 WP_000036378.1.3444 WP_000036378.1.34682 WP_000036378.1.34781 WP_000036378.1.34794 WP_000036378.1.34855 WP_000036378.1.34993 WP_000036378.1.35006 WP_000036378.1.35202 WP_000036378.1.35316 WP_000036378.1.35365 WP_000036378.1.35376 WP_000036378.1.3539 WP_000036378.1.35464 WP_000036378.1.35465 WP_000036378.1.35468 WP_000036378.1.35552 WP_000036378.1.35604 WP_000036378.1.35653 WP_000036378.1.35922 WP_000036378.1.35927 WP_000036378.1.35934 WP_000036378.1.35942 WP_000036378.1.35959 WP_000036378.1.36042 WP_000036378.1.36070 WP_000036378.1.36071 WP_000036378.1.36085 WP_000036378.1.36094 WP_000036378.1.36166 WP_000036378.1.36177 WP_000036378.1.3620 WP_000036378.1.36393 WP_000036378.1.36426 WP_000036378.1.36453 WP_000036378.1.36500 WP_000036378.1.36507 WP_000036378.1.36610 WP_000036378.1.36628 WP_000036378.1.36707 WP_000036378.1.36806 WP_000036378.1.36812 WP_000036378.1.36826 WP_000036378.1.36833 WP_000036378.1.36975 WP_000036378.1.37046 WP_000036378.1.37099 WP_000036378.1.37252 WP_000036378.1.37334 WP_000036378.1.37371 WP_000036378.1.37476 WP_000036378.1.37510 WP_000036378.1.37538 WP_000036378.1.37554 WP_000036378.1.37634 WP_000036378.1.377 WP_000036378.1.3772 WP_000036378.1.37758 WP_000036378.1.37773 WP_000036378.1.37852 WP_000036378.1.3788 WP_000036378.1.37887 WP_000036378.1.37917 WP_000036378.1.37926 WP_000036378.1.37995 WP_000036378.1.38033 WP_000036378.1.38081 WP_000036378.1.38103 WP_000036378.1.38162 WP_000036378.1.38257 WP_000036378.1.38314 WP_000036378.1.38323 WP_000036378.1.38357 WP_000036378.1.38412 WP_000036378.1.38626 WP_000036378.1.38629 WP_000036378.1.38694 WP_000036378.1.38722 WP_000036378.1.3873 WP_000036378.1.38811 WP_000036378.1.38896 WP_000036378.1.38911 WP_000036378.1.38920 WP_000036378.1.38935 WP_000036378.1.39005 WP_000036378.1.39037 WP_000036378.1.3904 WP_000036378.1.39042 WP_000036378.1.39103 WP_000036378.1.39123 WP_000036378.1.39150 WP_000036378.1.39302 WP_000036378.1.39305 WP_000036378.1.39481 WP_000036378.1.39509 WP_000036378.1.39531 WP_000036378.1.3954 WP_000036378.1.39610 WP_000036378.1.39690 WP_000036378.1.3970 WP_000036378.1.39758 WP_000036378.1.39780 WP_000036378.1.39818 WP_000036378.1.39822 WP_000036378.1.40088 WP_000036378.1.4020 WP_000036378.1.40206 WP_000036378.1.40249 WP_000036378.1.40315 WP_000036378.1.40335 WP_000036378.1.40382 WP_000036378.1.40391 WP_000036378.1.40403 WP_000036378.1.4049 WP_000036378.1.40502 WP_000036378.1.40509 WP_000036378.1.40563 WP_000036378.1.40599 WP_000036378.1.40617 WP_000036378.1.40781 WP_000036378.1.40813 WP_000036378.1.4082 WP_000036378.1.40865 WP_000036378.1.40898 WP_000036378.1.41037 WP_000036378.1.41125 WP_000036378.1.41147 WP_000036378.1.41263 WP_000036378.1.41287 WP_000036378.1.41315 WP_000036378.1.41368 WP_000036378.1.41371 WP_000036378.1.41392 WP_000036378.1.41402 WP_000036378.1.41407 WP_000036378.1.4142 WP_000036378.1.41455 WP_000036378.1.41466 WP_000036378.1.41545 WP_000036378.1.41566 WP_000036378.1.41613 WP_000036378.1.41621 WP_000036378.1.41654 WP_000036378.1.41712 WP_000036378.1.4172 WP_000036378.1.41740 WP_000036378.1.41752 WP_000036378.1.41780 WP_000036378.1.42027 WP_000036378.1.42038 WP_000036378.1.42060 WP_000036378.1.42138 WP_000036378.1.42203 WP_000036378.1.42226 WP_000036378.1.4224 WP_000036378.1.42252 WP_000036378.1.42367 WP_000036378.1.42387 WP_000036378.1.42415 WP_000036378.1.42442 WP_000036378.1.42480 WP_000036378.1.42522 WP_000036378.1.42632 WP_000036378.1.42661 WP_000036378.1.42669 WP_000036378.1.42748 WP_000036378.1.42749 WP_000036378.1.42756 WP_000036378.1.42813 WP_000036378.1.42832 WP_000036378.1.42891 WP_000036378.1.42937 WP_000036378.1.42950 WP_000036378.1.42962 WP_000036378.1.42987 WP_000036378.1.43132 WP_000036378.1.43137 WP_000036378.1.43166 WP_000036378.1.43177 WP_000036378.1.43213 WP_000036378.1.43239 WP_000036378.1.43316 WP_000036378.1.43363 WP_000036378.1.43389 WP_000036378.1.4342 WP_000036378.1.43455 WP_000036378.1.43474 WP_000036378.1.43642 WP_000036378.1.43750 WP_000036378.1.43858 WP_000036378.1.43925 WP_000036378.1.44018 WP_000036378.1.44040 WP_000036378.1.4415 WP_000036378.1.44238 WP_000036378.1.44285 WP_000036378.1.44292 WP_000036378.1.44445 WP_000036378.1.44461 WP_000036378.1.4449 WP_000036378.1.44524 WP_000036378.1.44587 WP_000036378.1.44608 WP_000036378.1.44661 WP_000036378.1.44756 WP_000036378.1.44857 WP_000036378.1.44961 WP_000036378.1.45053 WP_000036378.1.45301 WP_000036378.1.45329 WP_000036378.1.45359 WP_000036378.1.45444 WP_000036378.1.45600 WP_000036378.1.4570 WP_000036378.1.45718 WP_000036378.1.4574 WP_000036378.1.45840 WP_000036378.1.45865 WP_000036378.1.45868 WP_000036378.1.45930 WP_000036378.1.45960 WP_000036378.1.4600 WP_000036378.1.46027 WP_000036378.1.46048 WP_000036378.1.46049 WP_000036378.1.46070 WP_000036378.1.46081 WP_000036378.1.46105 WP_000036378.1.4613 WP_000036378.1.46197 WP_000036378.1.46239 WP_000036378.1.46257 WP_000036378.1.46301 WP_000036378.1.46433 WP_000036378.1.4646 WP_000036378.1.46477 WP_000036378.1.46526 WP_000036378.1.46552 WP_000036378.1.46555 WP_000036378.1.4657 WP_000036378.1.46602 WP_000036378.1.46614 WP_000036378.1.46616 WP_000036378.1.46668 WP_000036378.1.46743 WP_000036378.1.46821 WP_000036378.1.46860 WP_000036378.1.46876 WP_000036378.1.46882 WP_000036378.1.46898 WP_000036378.1.4691 WP_000036378.1.46912 WP_000036378.1.46990 WP_000036378.1.46999 WP_000036378.1.47028 WP_000036378.1.47029 WP_000036378.1.47034 WP_000036378.1.47050 WP_000036378.1.47069 WP_000036378.1.47246 WP_000036378.1.47280 WP_000036378.1.47307 WP_000036378.1.47319 WP_000036378.1.47332 WP_000036378.1.47370 WP_000036378.1.47398 WP_000036378.1.4740 WP_000036378.1.47473 WP_000036378.1.47477 WP_000036378.1.47529 WP_000036378.1.47555 WP_000036378.1.47734 WP_000036378.1.47770 WP_000036378.1.47820 WP_000036378.1.47848 WP_000036378.1.4785 WP_000036378.1.47962 WP_000036378.1.47976 WP_000036378.1.48000 WP_000036378.1.48077 WP_000036378.1.48144 WP_000036378.1.48188 WP_000036378.1.48222 WP_000036378.1.48291 WP_000036378.1.48355 WP_000036378.1.48385 WP_000036378.1.48433 WP_000036378.1.4857 WP_000036378.1.48571 WP_000036378.1.48678 WP_000036378.1.48771 WP_000036378.1.48801 WP_000036378.1.48860 WP_000036378.1.48901 WP_000036378.1.48921 WP_000036378.1.48928 WP_000036378.1.48954 WP_000036378.1.49107 WP_000036378.1.49124 WP_000036378.1.49147 WP_000036378.1.49190 WP_000036378.1.49229 WP_000036378.1.49243 WP_000036378.1.49336 WP_000036378.1.49459 WP_000036378.1.49481 WP_000036378.1.49546 WP_000036378.1.49558 WP_000036378.1.49599 WP_000036378.1.49712 WP_000036378.1.49722 WP_000036378.1.49747 WP_000036378.1.49774 WP_000036378.1.49856 WP_000036378.1.49861 WP_000036378.1.49879 WP_000036378.1.49950 WP_000036378.1.49954 WP_000036378.1.49987 WP_000036378.1.50113 WP_000036378.1.50119 WP_000036378.1.50182 WP_000036378.1.50207 WP_000036378.1.50258 WP_000036378.1.50269 WP_000036378.1.50353 WP_000036378.1.50361 WP_000036378.1.50366 WP_000036378.1.50412 WP_000036378.1.50418 WP_000036378.1.50586 WP_000036378.1.5064 WP_000036378.1.50715 WP_000036378.1.50725 WP_000036378.1.50939 WP_000036378.1.50969 WP_000036378.1.50996 WP_000036378.1.51013 WP_000036378.1.51058 WP_000036378.1.51175 WP_000036378.1.51248 WP_000036378.1.51260 WP_000036378.1.51278 WP_000036378.1.5128 WP_000036378.1.51299 WP_000036378.1.51323 WP_000036378.1.51405 WP_000036378.1.51427 WP_000036378.1.51430 WP_000036378.1.51462 WP_000036378.1.51490 WP_000036378.1.51537 WP_000036378.1.5157 WP_000036378.1.51707 WP_000036378.1.51718 WP_000036378.1.5172 WP_000036378.1.51784 WP_000036378.1.51839 WP_000036378.1.51873 WP_000036378.1.51985 WP_000036378.1.51988 WP_000036378.1.51999 WP_000036378.1.52002 WP_000036378.1.52171 WP_000036378.1.5227 WP_000036378.1.52272 WP_000036378.1.52378 WP_000036378.1.5239 WP_000036378.1.52419 WP_000036378.1.52568 WP_000036378.1.52612 WP_000036378.1.52691 WP_000036378.1.52710 WP_000036378.1.52735 WP_000036378.1.52762 WP_000036378.1.52777 WP_000036378.1.52801 WP_000036378.1.52846 WP_000036378.1.52913 WP_000036378.1.52962 WP_000036378.1.52995 WP_000036378.1.53027 WP_000036378.1.5310 WP_000036378.1.53155 WP_000036378.1.532 WP_000036378.1.53223 WP_000036378.1.53228 WP_000036378.1.53238 WP_000036378.1.53242 WP_000036378.1.53251 WP_000036378.1.53262 WP_000036378.1.53356 WP_000036378.1.53364 WP_000036378.1.53401 WP_000036378.1.5342 WP_000036378.1.53537 WP_000036378.1.53590 WP_000036378.1.5362 WP_000036378.1.53642 WP_000036378.1.53645 WP_000036378.1.53706 WP_000036378.1.53809 WP_000036378.1.53810 WP_000036378.1.53863 WP_000036378.1.53866 WP_000036378.1.5393 WP_000036378.1.53966 WP_000036378.1.53978 WP_000036378.1.54023 WP_000036378.1.54028 WP_000036378.1.54072 WP_000036378.1.54091 WP_000036378.1.54144 WP_000036378.1.54169 WP_000036378.1.54202 WP_000036378.1.54307 WP_000036378.1.54317 WP_000036378.1.54359 WP_000036378.1.54463 WP_000036378.1.54546 WP_000036378.1.54591 WP_000036378.1.54620 WP_000036378.1.54638 WP_000036378.1.54688 WP_000036378.1.5470 WP_000036378.1.54708 WP_000036378.1.54725 WP_000036378.1.54729 WP_000036378.1.5479 WP_000036378.1.54798 WP_000036378.1.54817 WP_000036378.1.54918 WP_000036378.1.54927 WP_000036378.1.54991 WP_000036378.1.55009 WP_000036378.1.55041 WP_000036378.1.55112 WP_000036378.1.55115 WP_000036378.1.55134 WP_000036378.1.55197 WP_000036378.1.5520 WP_000036378.1.55222 WP_000036378.1.55338 WP_000036378.1.55342 WP_000036378.1.55357 WP_000036378.1.55374 WP_000036378.1.55381 WP_000036378.1.55417 WP_000036378.1.55425 WP_000036378.1.55552 WP_000036378.1.55556 WP_000036378.1.55597 WP_000036378.1.55608 WP_000036378.1.5561 WP_000036378.1.5570 WP_000036378.1.55709 WP_000036378.1.55730 WP_000036378.1.55787 WP_000036378.1.55844 WP_000036378.1.55988 WP_000036378.1.56149 WP_000036378.1.56177 WP_000036378.1.56216 WP_000036378.1.56231 WP_000036378.1.56302 WP_000036378.1.56371 WP_000036378.1.56390 WP_000036378.1.56399 WP_000036378.1.5646 WP_000036378.1.56543 WP_000036378.1.56586 WP_000036378.1.56680 WP_000036378.1.56689 WP_000036378.1.5670 WP_000036378.1.56704 WP_000036378.1.56721 WP_000036378.1.56742 WP_000036378.1.56835 WP_000036378.1.5685 WP_000036378.1.56871 WP_000036378.1.56882 WP_000036378.1.57072 WP_000036378.1.57100 WP_000036378.1.57185 WP_000036378.1.57216 WP_000036378.1.57222 WP_000036378.1.57281 WP_000036378.1.5748 WP_000036378.1.57487 WP_000036378.1.57538 WP_000036378.1.5755 WP_000036378.1.57638 WP_000036378.1.57659 WP_000036378.1.57669 WP_000036378.1.57738 WP_000036378.1.57812 WP_000036378.1.57920 WP_000036378.1.58001 WP_000036378.1.58022 WP_000036378.1.58128 WP_000036378.1.58143 WP_000036378.1.58146 WP_000036378.1.58163 WP_000036378.1.58172 WP_000036378.1.58226 WP_000036378.1.58267 WP_000036378.1.58289 WP_000036378.1.58316 WP_000036378.1.58371 WP_000036378.1.58445 WP_000036378.1.58507 WP_000036378.1.58514 WP_000036378.1.58528 WP_000036378.1.58547 WP_000036378.1.58572 WP_000036378.1.58582 WP_000036378.1.58622 WP_000036378.1.58705 WP_000036378.1.58870 WP_000036378.1.58977 WP_000036378.1.58983 WP_000036378.1.59083 WP_000036378.1.59190 WP_000036378.1.59199 WP_000036378.1.59280 WP_000036378.1.59293 WP_000036378.1.59409 WP_000036378.1.59413 WP_000036378.1.59434 WP_000036378.1.59590 WP_000036378.1.59621 WP_000036378.1.59638 WP_000036378.1.59699 WP_000036378.1.59717 WP_000036378.1.59737 WP_000036378.1.59782 WP_000036378.1.59791 WP_000036378.1.59836 WP_000036378.1.59932 WP_000036378.1.60070 WP_000036378.1.60095 WP_000036378.1.6022 WP_000036378.1.60325 WP_000036378.1.60387 WP_000036378.1.60457 WP_000036378.1.60491 WP_000036378.1.60505 WP_000036378.1.6059 WP_000036378.1.60606 WP_000036378.1.6064 WP_000036378.1.60698 WP_000036378.1.60732 WP_000036378.1.60832 WP_000036378.1.60835 WP_000036378.1.61008 WP_000036378.1.61035 WP_000036378.1.61058 WP_000036378.1.6110 WP_000036378.1.61112 WP_000036378.1.61174 WP_000036378.1.61225 WP_000036378.1.61292 WP_000036378.1.61398 WP_000036378.1.61512 WP_000036378.1.61636 WP_000036378.1.61663 WP_000036378.1.61758 WP_000036378.1.61806 WP_000036378.1.61926 WP_000036378.1.61939 WP_000036378.1.61948 WP_000036378.1.61955 WP_000036378.1.61957 WP_000036378.1.62041 WP_000036378.1.6212 WP_000036378.1.62264 WP_000036378.1.62290 WP_000036378.1.62337 WP_000036378.1.62358 WP_000036378.1.62447 WP_000036378.1.62487 WP_000036378.1.62514 WP_000036378.1.62529 WP_000036378.1.62646 WP_000036378.1.62681 WP_000036378.1.62714 WP_000036378.1.62762 WP_000036378.1.62769 WP_000036378.1.62818 WP_000036378.1.62850 WP_000036378.1.62851 WP_000036378.1.62931 WP_000036378.1.62959 WP_000036378.1.62973 WP_000036378.1.6299 WP_000036378.1.63177 WP_000036378.1.63370 WP_000036378.1.63374 WP_000036378.1.63393 WP_000036378.1.63437 WP_000036378.1.63466 WP_000036378.1.63467 WP_000036378.1.63470 WP_000036378.1.63484 WP_000036378.1.63536 WP_000036378.1.63556 WP_000036378.1.63576 WP_000036378.1.63666 WP_000036378.1.63679 WP_000036378.1.63746 WP_000036378.1.63821 WP_000036378.1.64014 WP_000036378.1.64050 WP_000036378.1.64074 WP_000036378.1.64150 WP_000036378.1.64193 WP_000036378.1.64286 WP_000036378.1.64355 WP_000036378.1.64356 WP_000036378.1.64380 WP_000036378.1.64391 WP_000036378.1.6441 WP_000036378.1.64438 WP_000036378.1.64458 WP_000036378.1.64519 WP_000036378.1.64528 WP_000036378.1.64657 WP_000036378.1.64693 WP_000036378.1.647 WP_000036378.1.64707 WP_000036378.1.64881 WP_000036378.1.64970 WP_000036378.1.65023 WP_000036378.1.65097 WP_000036378.1.65155 WP_000036378.1.65179 WP_000036378.1.65305 WP_000036378.1.65370 WP_000036378.1.654 WP_000036378.1.65408 WP_000036378.1.65413 WP_000036378.1.65493 WP_000036378.1.65531 WP_000036378.1.65581 WP_000036378.1.65708 WP_000036378.1.65762 WP_000036378.1.65962 WP_000036378.1.6599 WP_000036378.1.65991 WP_000036378.1.66001 WP_000036378.1.66007 WP_000036378.1.6604 WP_000036378.1.66094 WP_000036378.1.66121 WP_000036378.1.66181 WP_000036378.1.66187 WP_000036378.1.66288 WP_000036378.1.66327 WP_000036378.1.66395 WP_000036378.1.66412 WP_000036378.1.6645 WP_000036378.1.66579 WP_000036378.1.66624 WP_000036378.1.66644 WP_000036378.1.66758 WP_000036378.1.6676 WP_000036378.1.66849 WP_000036378.1.66926 WP_000036378.1.66948 WP_000036378.1.67018 WP_000036378.1.67022 WP_000036378.1.67026 WP_000036378.1.67102 WP_000036378.1.67194 WP_000036378.1.67209 WP_000036378.1.6723 WP_000036378.1.6735 WP_000036378.1.67383 WP_000036378.1.67452 WP_000036378.1.67454 WP_000036378.1.67522 WP_000036378.1.67581 WP_000036378.1.67663 WP_000036378.1.67701 WP_000036378.1.67724 WP_000036378.1.67788 WP_000036378.1.678 WP_000036378.1.67841 WP_000036378.1.67861 WP_000036378.1.67999 WP_000036378.1.68011 WP_000036378.1.6802 WP_000036378.1.682 WP_000036378.1.68241 WP_000036378.1.68255 WP_000036378.1.68278 WP_000036378.1.68347 WP_000036378.1.68442 WP_000036378.1.6860 WP_000036378.1.68609 WP_000036378.1.68673 WP_000036378.1.68678 WP_000036378.1.68751 WP_000036378.1.68873 WP_000036378.1.69098 WP_000036378.1.69126 WP_000036378.1.69127 WP_000036378.1.69144 WP_000036378.1.69258 WP_000036378.1.69390 WP_000036378.1.69472 WP_000036378.1.69551 WP_000036378.1.69589 WP_000036378.1.69649 WP_000036378.1.69689 WP_000036378.1.69887 WP_000036378.1.69972 WP_000036378.1.70063 WP_000036378.1.70213 WP_000036378.1.70357 WP_000036378.1.70414 WP_000036378.1.70477 WP_000036378.1.7052 WP_000036378.1.70578 WP_000036378.1.70592 WP_000036378.1.70628 WP_000036378.1.70694 WP_000036378.1.70745 WP_000036378.1.70748 WP_000036378.1.70801 WP_000036378.1.70803 WP_000036378.1.70952 WP_000036378.1.70967 WP_000036378.1.71042 WP_000036378.1.71062 WP_000036378.1.71109 WP_000036378.1.71113 WP_000036378.1.71134 WP_000036378.1.71162 WP_000036378.1.71199 WP_000036378.1.71221 WP_000036378.1.71275 WP_000036378.1.71339 WP_000036378.1.71409 WP_000036378.1.71537 WP_000036378.1.71680 WP_000036378.1.71712 WP_000036378.1.71757 WP_000036378.1.71856 WP_000036378.1.71874 WP_000036378.1.71987 WP_000036378.1.72013 WP_000036378.1.72021 WP_000036378.1.72125 WP_000036378.1.72141 WP_000036378.1.72240 WP_000036378.1.72261 WP_000036378.1.72270 WP_000036378.1.72493 WP_000036378.1.72521 WP_000036378.1.72535 WP_000036378.1.72582 WP_000036378.1.72606 WP_000036378.1.72608 WP_000036378.1.72643 WP_000036378.1.72695 WP_000036378.1.72725 WP_000036378.1.72729 WP_000036378.1.72758 WP_000036378.1.72764 WP_000036378.1.7277 WP_000036378.1.72837 WP_000036378.1.72858 WP_000036378.1.72869 WP_000036378.1.73010 WP_000036378.1.73032 WP_000036378.1.73072 WP_000036378.1.73075 WP_000036378.1.73197 WP_000036378.1.73239 WP_000036378.1.73249 WP_000036378.1.73251 WP_000036378.1.73257 WP_000036378.1.73326 WP_000036378.1.73349 WP_000036378.1.73428 WP_000036378.1.73468 WP_000036378.1.7349 WP_000036378.1.73663 WP_000036378.1.73700 WP_000036378.1.73709 WP_000036378.1.73797 WP_000036378.1.73807 WP_000036378.1.73897 WP_000036378.1.73908 WP_000036378.1.73995 WP_000036378.1.73996 WP_000036378.1.74051 WP_000036378.1.74123 WP_000036378.1.7413 WP_000036378.1.74156 WP_000036378.1.7425 WP_000036378.1.74423 WP_000036378.1.74431 WP_000036378.1.74444 WP_000036378.1.74478 WP_000036378.1.74491 WP_000036378.1.74501 WP_000036378.1.74513 WP_000036378.1.74532 WP_000036378.1.74624 WP_000036378.1.74652 WP_000036378.1.74687 WP_000036378.1.74689 WP_000036378.1.74705 WP_000036378.1.74735 WP_000036378.1.74752 WP_000036378.1.7478 WP_000036378.1.74811 WP_000036378.1.74844 WP_000036378.1.74852 WP_000036378.1.74885 WP_000036378.1.74889 WP_000036378.1.74895 WP_000036378.1.75021 WP_000036378.1.75029 WP_000036378.1.75050 WP_000036378.1.75112 WP_000036378.1.75136 WP_000036378.1.75181 WP_000036378.1.75209 WP_000036378.1.75254 WP_000036378.1.75270 WP_000036378.1.75360 WP_000036378.1.75435 WP_000036378.1.75465 WP_000036378.1.75529 WP_000036378.1.75588 WP_000036378.1.75629 WP_000036378.1.75644 WP_000036378.1.75676 WP_000036378.1.75696 WP_000036378.1.75973 WP_000036378.1.75999 WP_000036378.1.76009 WP_000036378.1.7603 WP_000036378.1.76036 WP_000036378.1.76087 WP_000036378.1.76103 WP_000036378.1.76129 WP_000036378.1.76384 WP_000036378.1.76542 WP_000036378.1.76595 WP_000036378.1.7661 WP_000036378.1.76619 WP_000036378.1.76656 WP_000036378.1.76840 WP_000036378.1.76965 WP_000036378.1.76966 WP_000036378.1.7699 WP_000036378.1.77015 WP_000036378.1.77022 WP_000036378.1.77070 WP_000036378.1.77109 WP_000036378.1.77147 WP_000036378.1.77162 WP_000036378.1.77163 WP_000036378.1.77255 WP_000036378.1.77258 WP_000036378.1.77284 WP_000036378.1.77291 WP_000036378.1.7731 WP_000036378.1.77341 WP_000036378.1.77437 WP_000036378.1.77462 WP_000036378.1.77471 WP_000036378.1.77477 WP_000036378.1.77495 WP_000036378.1.77551 WP_000036378.1.77581 WP_000036378.1.77608 WP_000036378.1.77626 WP_000036378.1.77767 WP_000036378.1.7781 WP_000036378.1.77833 WP_000036378.1.77929 WP_000036378.1.77999 WP_000036378.1.78000 WP_000036378.1.78099 WP_000036378.1.78102 WP_000036378.1.78297 WP_000036378.1.78445 WP_000036378.1.78515 WP_000036378.1.78586 WP_000036378.1.78610 WP_000036378.1.78612 WP_000036378.1.78683 WP_000036378.1.78698 WP_000036378.1.78718 WP_000036378.1.78757 WP_000036378.1.78775 WP_000036378.1.7883 WP_000036378.1.78843 WP_000036378.1.78854 WP_000036378.1.78888 WP_000036378.1.78891 WP_000036378.1.78919 WP_000036378.1.78966 WP_000036378.1.7898 WP_000036378.1.7901 WP_000036378.1.79065 WP_000036378.1.79067 WP_000036378.1.79075 WP_000036378.1.79346 WP_000036378.1.7937 WP_000036378.1.79391 WP_000036378.1.79519 WP_000036378.1.79525 WP_000036378.1.79526 WP_000036378.1.79540 WP_000036378.1.79606 WP_000036378.1.79800 WP_000036378.1.79824 WP_000036378.1.79905 WP_000036378.1.79930 WP_000036378.1.79936 WP_000036378.1.80043 WP_000036378.1.8007 WP_000036378.1.80071 WP_000036378.1.80112 WP_000036378.1.80141 WP_000036378.1.80310 WP_000036378.1.80426 WP_000036378.1.80484 WP_000036378.1.80709 WP_000036378.1.80737 WP_000036378.1.80754 WP_000036378.1.80789 WP_000036378.1.80805 WP_000036378.1.80884 WP_000036378.1.80894 WP_000036378.1.80945 WP_000036378.1.80946 WP_000036378.1.80983 WP_000036378.1.80985 WP_000036378.1.810 WP_000036378.1.81026 WP_000036378.1.81034 WP_000036378.1.811 WP_000036378.1.81104 WP_000036378.1.81165 WP_000036378.1.81182 WP_000036378.1.81283 WP_000036378.1.81316 WP_000036378.1.81376 WP_000036378.1.81391 WP_000036378.1.81475 WP_000036378.1.81517 WP_000036378.1.81580 WP_000036378.1.81596 WP_000036378.1.81625 WP_000036378.1.81723 WP_000036378.1.81869 WP_000036378.1.81914 WP_000036378.1.81972 WP_000036378.1.82 WP_000036378.1.82059 WP_000036378.1.82062 WP_000036378.1.82137 WP_000036378.1.82217 WP_000036378.1.82239 WP_000036378.1.82240 WP_000036378.1.82242 WP_000036378.1.82246 WP_000036378.1.82275 WP_000036378.1.82326 WP_000036378.1.82378 WP_000036378.1.82485 WP_000036378.1.82499 WP_000036378.1.82572 WP_000036378.1.82626 WP_000036378.1.82682 WP_000036378.1.8277 WP_000036378.1.82831 WP_000036378.1.82902 WP_000036378.1.83035 WP_000036378.1.8306 WP_000036378.1.83093 WP_000036378.1.83205 WP_000036378.1.83347 WP_000036378.1.83481 WP_000036378.1.83564 WP_000036378.1.83584 WP_000036378.1.83684 WP_000036378.1.83762 WP_000036378.1.83947 WP_000036378.1.84060 WP_000036378.1.84140 WP_000036378.1.84172 WP_000036378.1.84348 WP_000036378.1.84436 WP_000036378.1.84473 WP_000036378.1.84511 WP_000036378.1.84656 WP_000036378.1.84784 WP_000036378.1.84850 WP_000036378.1.84881 WP_000036378.1.84893 WP_000036378.1.84941 WP_000036378.1.85011 WP_000036378.1.85052 WP_000036378.1.85098 WP_000036378.1.85105 WP_000036378.1.85112 WP_000036378.1.85129 WP_000036378.1.85175 WP_000036378.1.85320 WP_000036378.1.85335 WP_000036378.1.85342 WP_000036378.1.85500 WP_000036378.1.85525 WP_000036378.1.85762 WP_000036378.1.85939 WP_000036378.1.85944 WP_000036378.1.86016 WP_000036378.1.8607 WP_000036378.1.86115 WP_000036378.1.86149 WP_000036378.1.86181 WP_000036378.1.86210 WP_000036378.1.86266 WP_000036378.1.86307 WP_000036378.1.86355 WP_000036378.1.86364 WP_000036378.1.86371 WP_000036378.1.86376 WP_000036378.1.86393 WP_000036378.1.86411 WP_000036378.1.86451 WP_000036378.1.86454 WP_000036378.1.86492 WP_000036378.1.86583 WP_000036378.1.86598 WP_000036378.1.86617 WP_000036378.1.86640 WP_000036378.1.86667 WP_000036378.1.86674 WP_000036378.1.86707 WP_000036378.1.86833 WP_000036378.1.8687 WP_000036378.1.87075 WP_000036378.1.87109 WP_000036378.1.8711 WP_000036378.1.87310 WP_000036378.1.87358 WP_000036378.1.87400 WP_000036378.1.87410 WP_000036378.1.87465 WP_000036378.1.87557 WP_000036378.1.87607 WP_000036378.1.87639 WP_000036378.1.87694 WP_000036378.1.87728 WP_000036378.1.87788 WP_000036378.1.87789 WP_000036378.1.87822 WP_000036378.1.87973 WP_000036378.1.87976 WP_000036378.1.88020 WP_000036378.1.88155 WP_000036378.1.88238 WP_000036378.1.88252 WP_000036378.1.88285 WP_000036378.1.88376 WP_000036378.1.88379 WP_000036378.1.88384 WP_000036378.1.88427 WP_000036378.1.88462 WP_000036378.1.88535 WP_000036378.1.88539 WP_000036378.1.88607 WP_000036378.1.88631 WP_000036378.1.88709 WP_000036378.1.88717 WP_000036378.1.88732 WP_000036378.1.88757 WP_000036378.1.88759 WP_000036378.1.88883 WP_000036378.1.88997 WP_000036378.1.89050 WP_000036378.1.8906 WP_000036378.1.89067 WP_000036378.1.89183 WP_000036378.1.89200 WP_000036378.1.8938 WP_000036378.1.89432 WP_000036378.1.8945 WP_000036378.1.89474 WP_000036378.1.89479 WP_000036378.1.89601 WP_000036378.1.89768 WP_000036378.1.89818 WP_000036378.1.89839 WP_000036378.1.89859 WP_000036378.1.89915 WP_000036378.1.89918 WP_000036378.1.89920 WP_000036378.1.90063 WP_000036378.1.9009 WP_000036378.1.9010 WP_000036378.1.90156 WP_000036378.1.90266 WP_000036378.1.90270 WP_000036378.1.90332 WP_000036378.1.90405 WP_000036378.1.90435 WP_000036378.1.90441 WP_000036378.1.90547 WP_000036378.1.9059 WP_000036378.1.90591 WP_000036378.1.9061 WP_000036378.1.90626 WP_000036378.1.90706 WP_000036378.1.9081 WP_000036378.1.90822 WP_000036378.1.90834 WP_000036378.1.90856 WP_000036378.1.90864 WP_000036378.1.90873 WP_000036378.1.90890 WP_000036378.1.90951 WP_000036378.1.90979 WP_000036378.1.91094 WP_000036378.1.91113 WP_000036378.1.91121 WP_000036378.1.91266 WP_000036378.1.91268 WP_000036378.1.91290 WP_000036378.1.91462 WP_000036378.1.91485 WP_000036378.1.915 WP_000036378.1.91516 WP_000036378.1.91565 WP_000036378.1.91596 WP_000036378.1.9160 WP_000036378.1.91644 WP_000036378.1.91672 WP_000036378.1.91685 WP_000036378.1.9171 WP_000036378.1.91739 WP_000036378.1.91782 WP_000036378.1.91787 WP_000036378.1.91879 WP_000036378.1.91959 WP_000036378.1.91971 WP_000036378.1.91994 WP_000036378.1.92014 WP_000036378.1.92048 WP_000036378.1.92058 WP_000036378.1.921 WP_000036378.1.92102 WP_000036378.1.92163 WP_000036378.1.92215 WP_000036378.1.92311 WP_000036378.1.92434 WP_000036378.1.92532 WP_000036378.1.9255 WP_000036378.1.92577 WP_000036378.1.92615 WP_000036378.1.9266 WP_000036378.1.92693 WP_000036378.1.92719 WP_000036378.1.92780 WP_000036378.1.93005 WP_000036378.1.93016 WP_000036378.1.93033 WP_000036378.1.93072 WP_000036378.1.93100 WP_000036378.1.93252 WP_000036378.1.93338 WP_000036378.1.93379 WP_000036378.1.93388 WP_000036378.1.93463 WP_000036378.1.93509 WP_000036378.1.93531 WP_000036378.1.93569 WP_000036378.1.93652 WP_000036378.1.93665 WP_000036378.1.93733 WP_000036378.1.93743 WP_000036378.1.93873 WP_000036378.1.93877 WP_000036378.1.93918 WP_000036378.1.93951 WP_000036378.1.94008 WP_000036378.1.94156 WP_000036378.1.94232 WP_000036378.1.94298 WP_000036378.1.94317 WP_000036378.1.94353 WP_000036378.1.94404 WP_000036378.1.94468 WP_000036378.1.94475 WP_000036378.1.94507 WP_000036378.1.94580 WP_000036378.1.94754 WP_000036378.1.94787 WP_000036378.1.94808 WP_000036378.1.94822 WP_000036378.1.94880 WP_000036378.1.94889 WP_000036378.1.94903 WP_000036378.1.9491 WP_000036378.1.95005 WP_000036378.1.95022 WP_000036378.1.9513 WP_000036378.1.95161 WP_000036378.1.95198 WP_000036378.1.95243 WP_000036378.1.95244 WP_000036378.1.95368 WP_000036378.1.95390 WP_000036378.1.95400 WP_000036378.1.95424 WP_000036378.1.95490 WP_000036378.1.95521 WP_000036378.1.95563 WP_000036378.1.9559 WP_000036378.1.95604 WP_000036378.1.95655 WP_000036378.1.95771 WP_000036378.1.95800 WP_000036378.1.95824 WP_000036378.1.95865 WP_000036378.1.95869 WP_000036378.1.95916 WP_000036378.1.95931 WP_000036378.1.96066 WP_000036378.1.96114 WP_000036378.1.96177 WP_000036378.1.96222 WP_000036378.1.96247 WP_000036378.1.96341 WP_000036378.1.96457 WP_000036378.1.96494 WP_000036378.1.965 WP_000036378.1.96562 WP_000036378.1.9661 WP_000036378.1.96617 WP_000036378.1.96659 WP_000036378.1.9668 WP_000036378.1.96743 WP_000036378.1.96817 WP_000036378.1.9691 WP_000036378.1.96924 WP_000036378.1.96936 WP_000036378.1.96944 WP_000036378.1.97049 WP_000036378.1.97059 WP_000036378.1.97200 WP_000036378.1.97248 WP_000036378.1.97344 WP_000036378.1.97356 WP_000036378.1.97361 WP_000036378.1.97421 WP_000036378.1.97434 WP_000036378.1.97544 WP_000036378.1.97685 WP_000036378.1.97705 WP_000036378.1.97822 WP_000036378.1.97932 WP_000036378.1.97937 WP_000036378.1.97962 WP_000036378.1.9803 WP_000036378.1.98082 WP_000036378.1.98115 WP_000036378.1.98139 WP_000036378.1.9816 WP_000036378.1.9817 WP_000036378.1.98232 WP_000036378.1.98239 WP_000036378.1.98292 WP_000036378.1.98294 WP_000036378.1.98301 WP_000036378.1.98357 WP_000036378.1.98400 WP_000036378.1.98451 WP_000036378.1.98549 WP_000036378.1.9858 WP_000036378.1.98614 WP_000036378.1.98665 WP_000036378.1.98702 WP_000036378.1.98875 WP_000036378.1.98988 WP_000036378.1.99046 WP_000036378.1.99246 WP_000036378.1.99295 WP_000036378.1.99302 WP_000036378.1.99304 WP_000036378.1.99334 WP_000036378.1.99345 WP_000036378.1.99361 WP_000036378.1.9940 WP_000036378.1.99471 WP_000036378.1.99475 WP_000036378.1.99486 WP_000036378.1.99534 WP_000036378.1.99562 WP_000036378.1.99592 WP_000036378.1.99603 WP_000036378.1.99619 WP_000036378.1.99632 WP_000036378.1.99666 WP_000036378.1.99827 WP_000036378.1.99869 YP_006778733.1.12065 gi|407469753|ref|YP_006783804.1| gi|407481584|ref|YP_006778733.1| gi|218554471|ref|YP_002387384.1| gi|386704391|ref|YP_006168238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]