SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A080KL08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080KL08
Domain Number 1 Region: 453-554
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A080KL08
Sequence length 557
Comment (tr|A0A080KL08|A0A080KL08_9GAMM) Sulfate permease or related transporter (MFS superfamily) {ECO:0000313|EMBL:KES19454.1} KW=Complete proteome; Reference proteome OX=1445513 OS=Gilliamella apicola SCGC AB-598-B02. GN=GASC598B02_015400 OC=Gilliamella.
Sequence
MKLYGLSGTKISCAFISACITTPYNTTRFIKDLIAGITVGIIAIPLAMALAIASGVPPQH
GLYTAIIAGFVIALTGGSRFSVSGPTAAFVVILYPVSLQYGLSGLLIATLLSGVFLILMG
MIRLGRLIEYIPLPVVLGFTSGIAITIATMQIKDFFGLTLEHMPESYISKVIELAKTLPS
INIADTIVGMVTLIVLIVWPKFRVKISGHLPALVAGIIVMFIFNQFGYQIETIGSRFTYT
LADNTIGHGIPSVLPEFILPWENTEFNWDWTTLSALLPISLTMAMLCAIESLLCAVVLDE
MTHTKHHSNSELIGQGLGNIIAPFFGGISATAAIARSAANVKAGATSPIAAVLHSLVVLL
ALICFAPLLSYIPLSAMAALLLIVAWNMSAVQRVMYIIKCAPKDDILIMLICMSLTVLFD
MVIAITLGIVLASILFMRRIARMTRLVELNRSDDKTLVLRVNGPLFFAAAEKTFVELYKK
INGYEHIILQWDAVPILDAGGLNALIHFIDELPEHVDLSICELQFQPLKTLARAKIVPIP
NKLMFFSTLDEALKDKE
Download sequence
Identical sequences A0A080KL08 A0A242NMZ5
WP_039127393.1.32150 WP_039127393.1.80642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]