SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080M416 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080M416
Domain Number 1 Region: 164-376
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 5.47e-61
Family Class I glutamine amidotransferases (GAT) 0.000000143
Further Details:      
 
Domain Number 2 Region: 9-146
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 7.45e-56
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.00000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A080M416
Sequence length 385
Comment (tr|A0A080M416|A0A080M416_9PROT) Carbamoyl-phosphate synthetase glutamine chain {ECO:0000256|HAMAP-Rule:MF_01209} KW=Complete proteome; Reference proteome OX=1453999 OS=Candidatus Accumulibacter sp. SK-02. GN=AW06_003797 OC=Candidatus Accumulibacter.
Sequence
MSLLPSLPPAILALADGTIFRGLAIGAGGCTSGEVVFNTAMTGYQEILTDPSYCRQIVTL
TYPHIGNVGCNAEDFESPGNHAAGLVIRDLPVRAANWRLQETLPEYLQKHGIVAIAGIDT
RKLTRLLREKGAQAGCIMAVEVDDRRARAEAVAFPGLAGMDLARVVSVQSSYDWAGGPWR
LGGYVAAPAPLWHVVAYDFGVKHNILRLLAARGCRVTVVPAQTTAAEVLKLKPNGVFLSN
GPGDPEPCDYAITAIREILARGVPMFGICLGHQLLALASGARTMKMKFGHHGANHPVKDL
QTGQVLITSQNHGFAVDADTLPANLLATHMSLFDGSLQGLARSDLPAFSFQGHPEASPGP
HDIAYLFDRFVKMMQDEKAKHAQTH
Download sequence
Identical sequences A0A080M416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]