SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A080VEH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080VEH0
Domain Number 1 Region: 149-332
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.15e-46
Family Methylesterase CheB, C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 4-61
Classification Level Classification E-value
Superfamily CheY-like 0.0000356
Family CheY-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A080VEH0
Sequence length 343
Comment (tr|A0A080VEH0|A0A080VEH0_PSEAI) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=287 OS=Pseudomonas aeruginosa. GN=AO964_26960 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSERATPRVAVIADTSLQRHVLQQALLGHGYEVVLNADPARVDDAALECAPDLWLVDLTQ
QDDSPLLDSLLEQDRAPVLFGEGHAPERHTEHYPRWERRLIGKLKRLIGDPSDGVGDSLG
ALLDEERPPRLEIPGDLAAMPLQAGEAAREVWLLAASLGGPAAVKAFLDALPGGLPIGFL
YAQHIDASFEQNLPQAVGRHSQWHVKNVRDGEALRCGEVMVVPVLHELGFHHDGRLKCSQ
RPWPEPYTPSIDQMMLNLAQQFGPDCGVIVFSGMGSDGSAAAAYVRRQGGEVWTQRADSC
VCSSMPDSLREAGYSSFNASPRELAEALVKHLAARCAPTGVET
Download sequence
Identical sequences A0A080VEH0 A0A0E1ANJ1 A0A1C7BB97 A0A1S1BV88 V6A8F0
gi|386056483|ref|YP_005973005.1| gi|386068676|ref|YP_005983980.1| gi|558676179|ref|YP_008812887.1| gi|568307170|ref|YP_008979439.1| gi|478476620|ref|YP_007707271.1| WP_003084598.1.100276 WP_003084598.1.100319 WP_003084598.1.100469 WP_003084598.1.100473 WP_003084598.1.100476 WP_003084598.1.100523 WP_003084598.1.100742 WP_003084598.1.101047 WP_003084598.1.101269 WP_003084598.1.101310 WP_003084598.1.101340 WP_003084598.1.101590 WP_003084598.1.101712 WP_003084598.1.10174 WP_003084598.1.101781 WP_003084598.1.101871 WP_003084598.1.10271 WP_003084598.1.10419 WP_003084598.1.10435 WP_003084598.1.10457 WP_003084598.1.10548 WP_003084598.1.10684 WP_003084598.1.10764 WP_003084598.1.11026 WP_003084598.1.11058 WP_003084598.1.11130 WP_003084598.1.11180 WP_003084598.1.11754 WP_003084598.1.1183 WP_003084598.1.1187 WP_003084598.1.11943 WP_003084598.1.12081 WP_003084598.1.12120 WP_003084598.1.12200 WP_003084598.1.12240 WP_003084598.1.12354 WP_003084598.1.1238 WP_003084598.1.12400 WP_003084598.1.12530 WP_003084598.1.12547 WP_003084598.1.12670 WP_003084598.1.12744 WP_003084598.1.12890 WP_003084598.1.12922 WP_003084598.1.12930 WP_003084598.1.12980 WP_003084598.1.13041 WP_003084598.1.13057 WP_003084598.1.13077 WP_003084598.1.13092 WP_003084598.1.13208 WP_003084598.1.13232 WP_003084598.1.13266 WP_003084598.1.13270 WP_003084598.1.13364 WP_003084598.1.13407 WP_003084598.1.13533 WP_003084598.1.13642 WP_003084598.1.14096 WP_003084598.1.14116 WP_003084598.1.14204 WP_003084598.1.14378 WP_003084598.1.14455 WP_003084598.1.14476 WP_003084598.1.14525 WP_003084598.1.14615 WP_003084598.1.14679 WP_003084598.1.14690 WP_003084598.1.14714 WP_003084598.1.1475 WP_003084598.1.14797 WP_003084598.1.14815 WP_003084598.1.14883 WP_003084598.1.14966 WP_003084598.1.14981 WP_003084598.1.1516 WP_003084598.1.15231 WP_003084598.1.15328 WP_003084598.1.15379 WP_003084598.1.15408 WP_003084598.1.15482 WP_003084598.1.15606 WP_003084598.1.15666 WP_003084598.1.15692 WP_003084598.1.15886 WP_003084598.1.15889 WP_003084598.1.16041 WP_003084598.1.16161 WP_003084598.1.16197 WP_003084598.1.16242 WP_003084598.1.16419 WP_003084598.1.1670 WP_003084598.1.16895 WP_003084598.1.1704 WP_003084598.1.17155 WP_003084598.1.17189 WP_003084598.1.172 WP_003084598.1.17499 WP_003084598.1.1758 WP_003084598.1.1761 WP_003084598.1.17697 WP_003084598.1.17890 WP_003084598.1.18054 WP_003084598.1.1824 WP_003084598.1.18349 WP_003084598.1.18547 WP_003084598.1.18732 WP_003084598.1.18735 WP_003084598.1.18795 WP_003084598.1.18892 WP_003084598.1.18930 WP_003084598.1.19251 WP_003084598.1.19260 WP_003084598.1.19346 WP_003084598.1.19703 WP_003084598.1.19718 WP_003084598.1.19803 WP_003084598.1.19824 WP_003084598.1.19930 WP_003084598.1.20024 WP_003084598.1.20134 WP_003084598.1.20154 WP_003084598.1.20590 WP_003084598.1.20682 WP_003084598.1.20692 WP_003084598.1.20854 WP_003084598.1.20978 WP_003084598.1.21002 WP_003084598.1.21039 WP_003084598.1.21096 WP_003084598.1.21209 WP_003084598.1.21253 WP_003084598.1.21471 WP_003084598.1.21517 WP_003084598.1.21744 WP_003084598.1.21871 WP_003084598.1.21891 WP_003084598.1.221 WP_003084598.1.22316 WP_003084598.1.2237 WP_003084598.1.22390 WP_003084598.1.22394 WP_003084598.1.22477 WP_003084598.1.22573 WP_003084598.1.22729 WP_003084598.1.22863 WP_003084598.1.23013 WP_003084598.1.23166 WP_003084598.1.23191 WP_003084598.1.23195 WP_003084598.1.23418 WP_003084598.1.23421 WP_003084598.1.23512 WP_003084598.1.23518 WP_003084598.1.23523 WP_003084598.1.2355 WP_003084598.1.23559 WP_003084598.1.23715 WP_003084598.1.2374 WP_003084598.1.23884 WP_003084598.1.23925 WP_003084598.1.23938 WP_003084598.1.24087 WP_003084598.1.24183 WP_003084598.1.24234 WP_003084598.1.24319 WP_003084598.1.24351 WP_003084598.1.24447 WP_003084598.1.2453 WP_003084598.1.24626 WP_003084598.1.2477 WP_003084598.1.24938 WP_003084598.1.24940 WP_003084598.1.25075 WP_003084598.1.251 WP_003084598.1.25142 WP_003084598.1.25179 WP_003084598.1.25271 WP_003084598.1.25641 WP_003084598.1.25675 WP_003084598.1.2572 WP_003084598.1.25834 WP_003084598.1.2596 WP_003084598.1.25964 WP_003084598.1.26010 WP_003084598.1.26042 WP_003084598.1.26553 WP_003084598.1.26816 WP_003084598.1.26862 WP_003084598.1.26906 WP_003084598.1.26967 WP_003084598.1.27039 WP_003084598.1.27073 WP_003084598.1.27211 WP_003084598.1.27218 WP_003084598.1.27259 WP_003084598.1.27288 WP_003084598.1.27549 WP_003084598.1.27687 WP_003084598.1.27772 WP_003084598.1.27825 WP_003084598.1.27837 WP_003084598.1.27858 WP_003084598.1.27933 WP_003084598.1.28057 WP_003084598.1.28064 WP_003084598.1.28078 WP_003084598.1.28175 WP_003084598.1.28193 WP_003084598.1.28404 WP_003084598.1.28505 WP_003084598.1.28528 WP_003084598.1.28602 WP_003084598.1.28699 WP_003084598.1.28713 WP_003084598.1.28800 WP_003084598.1.28838 WP_003084598.1.28878 WP_003084598.1.29003 WP_003084598.1.29008 WP_003084598.1.29062 WP_003084598.1.29070 WP_003084598.1.29127 WP_003084598.1.29137 WP_003084598.1.29179 WP_003084598.1.2927 WP_003084598.1.29401 WP_003084598.1.29438 WP_003084598.1.29440 WP_003084598.1.29501 WP_003084598.1.2961 WP_003084598.1.29633 WP_003084598.1.29650 WP_003084598.1.29753 WP_003084598.1.29920 WP_003084598.1.29958 WP_003084598.1.29973 WP_003084598.1.30020 WP_003084598.1.3030 WP_003084598.1.30625 WP_003084598.1.30693 WP_003084598.1.30842 WP_003084598.1.30943 WP_003084598.1.31279 WP_003084598.1.31587 WP_003084598.1.3172 WP_003084598.1.31732 WP_003084598.1.31751 WP_003084598.1.3179 WP_003084598.1.31848 WP_003084598.1.31852 WP_003084598.1.3189 WP_003084598.1.319 WP_003084598.1.32235 WP_003084598.1.32289 WP_003084598.1.32544 WP_003084598.1.32596 WP_003084598.1.32626 WP_003084598.1.32821 WP_003084598.1.32998 WP_003084598.1.33009 WP_003084598.1.33097 WP_003084598.1.33210 WP_003084598.1.33340 WP_003084598.1.33387 WP_003084598.1.33441 WP_003084598.1.33455 WP_003084598.1.3351 WP_003084598.1.33517 WP_003084598.1.33547 WP_003084598.1.33549 WP_003084598.1.33669 WP_003084598.1.3368 WP_003084598.1.33728 WP_003084598.1.33774 WP_003084598.1.33814 WP_003084598.1.3385 WP_003084598.1.33945 WP_003084598.1.34136 WP_003084598.1.34143 WP_003084598.1.34150 WP_003084598.1.34180 WP_003084598.1.34191 WP_003084598.1.34203 WP_003084598.1.34306 WP_003084598.1.3436 WP_003084598.1.34461 WP_003084598.1.34465 WP_003084598.1.34472 WP_003084598.1.3452 WP_003084598.1.34568 WP_003084598.1.34583 WP_003084598.1.34784 WP_003084598.1.34821 WP_003084598.1.34832 WP_003084598.1.34836 WP_003084598.1.34837 WP_003084598.1.34876 WP_003084598.1.34878 WP_003084598.1.34901 WP_003084598.1.35149 WP_003084598.1.35281 WP_003084598.1.3531 WP_003084598.1.35431 WP_003084598.1.35529 WP_003084598.1.3555 WP_003084598.1.35599 WP_003084598.1.35639 WP_003084598.1.35669 WP_003084598.1.35762 WP_003084598.1.35843 WP_003084598.1.35857 WP_003084598.1.35984 WP_003084598.1.36121 WP_003084598.1.36148 WP_003084598.1.36285 WP_003084598.1.36435 WP_003084598.1.36521 WP_003084598.1.36608 WP_003084598.1.36708 WP_003084598.1.3672 WP_003084598.1.36756 WP_003084598.1.37050 WP_003084598.1.37097 WP_003084598.1.37172 WP_003084598.1.37216 WP_003084598.1.37366 WP_003084598.1.37416 WP_003084598.1.3742 WP_003084598.1.37500 WP_003084598.1.37512 WP_003084598.1.3768 WP_003084598.1.37698 WP_003084598.1.37703 WP_003084598.1.3773 WP_003084598.1.37799 WP_003084598.1.37826 WP_003084598.1.3785 WP_003084598.1.38060 WP_003084598.1.3818 WP_003084598.1.3821 WP_003084598.1.3833 WP_003084598.1.38335 WP_003084598.1.38337 WP_003084598.1.38502 WP_003084598.1.38505 WP_003084598.1.38510 WP_003084598.1.38582 WP_003084598.1.38587 WP_003084598.1.3870 WP_003084598.1.38706 WP_003084598.1.3887 WP_003084598.1.39046 WP_003084598.1.39088 WP_003084598.1.39345 WP_003084598.1.39452 WP_003084598.1.39458 WP_003084598.1.39537 WP_003084598.1.39920 WP_003084598.1.39989 WP_003084598.1.40059 WP_003084598.1.40115 WP_003084598.1.40135 WP_003084598.1.40237 WP_003084598.1.40271 WP_003084598.1.4038 WP_003084598.1.40419 WP_003084598.1.40546 WP_003084598.1.40874 WP_003084598.1.40950 WP_003084598.1.40993 WP_003084598.1.41137 WP_003084598.1.41199 WP_003084598.1.41290 WP_003084598.1.41487 WP_003084598.1.41502 WP_003084598.1.41703 WP_003084598.1.41725 WP_003084598.1.41846 WP_003084598.1.4196 WP_003084598.1.42 WP_003084598.1.42041 WP_003084598.1.42047 WP_003084598.1.42294 WP_003084598.1.42381 WP_003084598.1.42388 WP_003084598.1.42411 WP_003084598.1.42463 WP_003084598.1.42508 WP_003084598.1.42634 WP_003084598.1.42690 WP_003084598.1.42723 WP_003084598.1.4273 WP_003084598.1.42754 WP_003084598.1.42854 WP_003084598.1.43022 WP_003084598.1.43212 WP_003084598.1.43245 WP_003084598.1.43315 WP_003084598.1.43326 WP_003084598.1.43330 WP_003084598.1.43356 WP_003084598.1.43662 WP_003084598.1.43696 WP_003084598.1.43729 WP_003084598.1.43802 WP_003084598.1.4381 WP_003084598.1.4397 WP_003084598.1.44269 WP_003084598.1.44373 WP_003084598.1.445 WP_003084598.1.44552 WP_003084598.1.44565 WP_003084598.1.44760 WP_003084598.1.44804 WP_003084598.1.44870 WP_003084598.1.45063 WP_003084598.1.45090 WP_003084598.1.45199 WP_003084598.1.4522 WP_003084598.1.45228 WP_003084598.1.45298 WP_003084598.1.45306 WP_003084598.1.45312 WP_003084598.1.4532 WP_003084598.1.45353 WP_003084598.1.45358 WP_003084598.1.45485 WP_003084598.1.45611 WP_003084598.1.45635 WP_003084598.1.45636 WP_003084598.1.45678 WP_003084598.1.45723 WP_003084598.1.45818 WP_003084598.1.45837 WP_003084598.1.45934 WP_003084598.1.45946 WP_003084598.1.46152 WP_003084598.1.4640 WP_003084598.1.46633 WP_003084598.1.46787 WP_003084598.1.46935 WP_003084598.1.47155 WP_003084598.1.47314 WP_003084598.1.47374 WP_003084598.1.47469 WP_003084598.1.47551 WP_003084598.1.47645 WP_003084598.1.47774 WP_003084598.1.47930 WP_003084598.1.47934 WP_003084598.1.48321 WP_003084598.1.48382 WP_003084598.1.48487 WP_003084598.1.48545 WP_003084598.1.48546 WP_003084598.1.48579 WP_003084598.1.48747 WP_003084598.1.48810 WP_003084598.1.48840 WP_003084598.1.4913 WP_003084598.1.49135 WP_003084598.1.49184 WP_003084598.1.49244 WP_003084598.1.49286 WP_003084598.1.49293 WP_003084598.1.49833 WP_003084598.1.49922 WP_003084598.1.49948 WP_003084598.1.49988 WP_003084598.1.50232 WP_003084598.1.50242 WP_003084598.1.50450 WP_003084598.1.50459 WP_003084598.1.50691 WP_003084598.1.50783 WP_003084598.1.50922 WP_003084598.1.50967 WP_003084598.1.51141 WP_003084598.1.51173 WP_003084598.1.51183 WP_003084598.1.51185 WP_003084598.1.51267 WP_003084598.1.51457 WP_003084598.1.51472 WP_003084598.1.51501 WP_003084598.1.51682 WP_003084598.1.51727 WP_003084598.1.51733 WP_003084598.1.51917 WP_003084598.1.51928 WP_003084598.1.51937 WP_003084598.1.52212 WP_003084598.1.52326 WP_003084598.1.52334 WP_003084598.1.52372 WP_003084598.1.52403 WP_003084598.1.52409 WP_003084598.1.52591 WP_003084598.1.52690 WP_003084598.1.52790 WP_003084598.1.5289 WP_003084598.1.52939 WP_003084598.1.53037 WP_003084598.1.53038 WP_003084598.1.53169 WP_003084598.1.53414 WP_003084598.1.53486 WP_003084598.1.53528 WP_003084598.1.53530 WP_003084598.1.53586 WP_003084598.1.53663 WP_003084598.1.53678 WP_003084598.1.5388 WP_003084598.1.53946 WP_003084598.1.53951 WP_003084598.1.54076 WP_003084598.1.54146 WP_003084598.1.54248 WP_003084598.1.54293 WP_003084598.1.54354 WP_003084598.1.54462 WP_003084598.1.54742 WP_003084598.1.54974 WP_003084598.1.55 WP_003084598.1.55318 WP_003084598.1.55400 WP_003084598.1.55445 WP_003084598.1.56037 WP_003084598.1.56187 WP_003084598.1.56229 WP_003084598.1.56442 WP_003084598.1.56452 WP_003084598.1.56465 WP_003084598.1.56623 WP_003084598.1.56797 WP_003084598.1.56837 WP_003084598.1.56896 WP_003084598.1.57005 WP_003084598.1.57065 WP_003084598.1.57113 WP_003084598.1.57339 WP_003084598.1.57417 WP_003084598.1.57477 WP_003084598.1.57792 WP_003084598.1.57841 WP_003084598.1.57853 WP_003084598.1.57921 WP_003084598.1.57966 WP_003084598.1.58056 WP_003084598.1.58417 WP_003084598.1.58482 WP_003084598.1.5850 WP_003084598.1.58527 WP_003084598.1.5856 WP_003084598.1.58581 WP_003084598.1.5869 WP_003084598.1.5889 WP_003084598.1.58952 WP_003084598.1.5897 WP_003084598.1.59013 WP_003084598.1.59076 WP_003084598.1.59099 WP_003084598.1.59123 WP_003084598.1.59156 WP_003084598.1.59158 WP_003084598.1.59212 WP_003084598.1.59246 WP_003084598.1.59288 WP_003084598.1.59339 WP_003084598.1.59376 WP_003084598.1.59385 WP_003084598.1.59563 WP_003084598.1.59943 WP_003084598.1.60079 WP_003084598.1.60206 WP_003084598.1.60261 WP_003084598.1.60364 WP_003084598.1.60396 WP_003084598.1.60415 WP_003084598.1.60603 WP_003084598.1.60679 WP_003084598.1.607 WP_003084598.1.60850 WP_003084598.1.60910 WP_003084598.1.60970 WP_003084598.1.60979 WP_003084598.1.61269 WP_003084598.1.61288 WP_003084598.1.61294 WP_003084598.1.61431 WP_003084598.1.616 WP_003084598.1.61696 WP_003084598.1.61943 WP_003084598.1.62010 WP_003084598.1.62035 WP_003084598.1.62211 WP_003084598.1.62263 WP_003084598.1.62516 WP_003084598.1.62534 WP_003084598.1.626 WP_003084598.1.62604 WP_003084598.1.62635 WP_003084598.1.62701 WP_003084598.1.62704 WP_003084598.1.62708 WP_003084598.1.62772 WP_003084598.1.6283 WP_003084598.1.62834 WP_003084598.1.62838 WP_003084598.1.62961 WP_003084598.1.62977 WP_003084598.1.63038 WP_003084598.1.63124 WP_003084598.1.63338 WP_003084598.1.63401 WP_003084598.1.63591 WP_003084598.1.63659 WP_003084598.1.63784 WP_003084598.1.63929 WP_003084598.1.63941 WP_003084598.1.64212 WP_003084598.1.64340 WP_003084598.1.6450 WP_003084598.1.64591 WP_003084598.1.64603 WP_003084598.1.64605 WP_003084598.1.64611 WP_003084598.1.64726 WP_003084598.1.64799 WP_003084598.1.64880 WP_003084598.1.64885 WP_003084598.1.65095 WP_003084598.1.65099 WP_003084598.1.65196 WP_003084598.1.65247 WP_003084598.1.65285 WP_003084598.1.65316 WP_003084598.1.65334 WP_003084598.1.65478 WP_003084598.1.65679 WP_003084598.1.65740 WP_003084598.1.65779 WP_003084598.1.65867 WP_003084598.1.66088 WP_003084598.1.6627 WP_003084598.1.66348 WP_003084598.1.66410 WP_003084598.1.66526 WP_003084598.1.66563 WP_003084598.1.66693 WP_003084598.1.66892 WP_003084598.1.66931 WP_003084598.1.66945 WP_003084598.1.66982 WP_003084598.1.67124 WP_003084598.1.67269 WP_003084598.1.67388 WP_003084598.1.67489 WP_003084598.1.67506 WP_003084598.1.67531 WP_003084598.1.6768 WP_003084598.1.67686 WP_003084598.1.67874 WP_003084598.1.67875 WP_003084598.1.67899 WP_003084598.1.67937 WP_003084598.1.6796 WP_003084598.1.68183 WP_003084598.1.68194 WP_003084598.1.68448 WP_003084598.1.68472 WP_003084598.1.6850 WP_003084598.1.6866 WP_003084598.1.68790 WP_003084598.1.68800 WP_003084598.1.68862 WP_003084598.1.68881 WP_003084598.1.6911 WP_003084598.1.69209 WP_003084598.1.69330 WP_003084598.1.6937 WP_003084598.1.69411 WP_003084598.1.69534 WP_003084598.1.69556 WP_003084598.1.69834 WP_003084598.1.70098 WP_003084598.1.70138 WP_003084598.1.70168 WP_003084598.1.70216 WP_003084598.1.70470 WP_003084598.1.70650 WP_003084598.1.70677 WP_003084598.1.71141 WP_003084598.1.71203 WP_003084598.1.71234 WP_003084598.1.71254 WP_003084598.1.71290 WP_003084598.1.71346 WP_003084598.1.71412 WP_003084598.1.71610 WP_003084598.1.71642 WP_003084598.1.71738 WP_003084598.1.71806 WP_003084598.1.71862 WP_003084598.1.71866 WP_003084598.1.71927 WP_003084598.1.72183 WP_003084598.1.7219 WP_003084598.1.72323 WP_003084598.1.72331 WP_003084598.1.72346 WP_003084598.1.72458 WP_003084598.1.72477 WP_003084598.1.72562 WP_003084598.1.72653 WP_003084598.1.72662 WP_003084598.1.72727 WP_003084598.1.7276 WP_003084598.1.72772 WP_003084598.1.72782 WP_003084598.1.72845 WP_003084598.1.73035 WP_003084598.1.73135 WP_003084598.1.73149 WP_003084598.1.73172 WP_003084598.1.73192 WP_003084598.1.73541 WP_003084598.1.73601 WP_003084598.1.73719 WP_003084598.1.7377 WP_003084598.1.73941 WP_003084598.1.74 WP_003084598.1.74167 WP_003084598.1.74264 WP_003084598.1.74287 WP_003084598.1.74475 WP_003084598.1.7448 WP_003084598.1.7456 WP_003084598.1.74637 WP_003084598.1.74878 WP_003084598.1.74941 WP_003084598.1.7501 WP_003084598.1.75389 WP_003084598.1.7547 WP_003084598.1.75580 WP_003084598.1.75631 WP_003084598.1.7568 WP_003084598.1.75756 WP_003084598.1.76092 WP_003084598.1.76322 WP_003084598.1.76383 WP_003084598.1.76467 WP_003084598.1.76484 WP_003084598.1.76543 WP_003084598.1.76861 WP_003084598.1.77442 WP_003084598.1.77476 WP_003084598.1.77490 WP_003084598.1.77686 WP_003084598.1.77750 WP_003084598.1.77769 WP_003084598.1.7779 WP_003084598.1.77834 WP_003084598.1.77913 WP_003084598.1.78104 WP_003084598.1.78134 WP_003084598.1.78148 WP_003084598.1.78158 WP_003084598.1.7840 WP_003084598.1.78425 WP_003084598.1.78430 WP_003084598.1.78437 WP_003084598.1.78599 WP_003084598.1.788 WP_003084598.1.7899 WP_003084598.1.79003 WP_003084598.1.79007 WP_003084598.1.79060 WP_003084598.1.79177 WP_003084598.1.79256 WP_003084598.1.79286 WP_003084598.1.79421 WP_003084598.1.79429 WP_003084598.1.79631 WP_003084598.1.79699 WP_003084598.1.79883 WP_003084598.1.799 WP_003084598.1.79902 WP_003084598.1.8 WP_003084598.1.80068 WP_003084598.1.80102 WP_003084598.1.8013 WP_003084598.1.80258 WP_003084598.1.8028 WP_003084598.1.80411 WP_003084598.1.80454 WP_003084598.1.80481 WP_003084598.1.8051 WP_003084598.1.80572 WP_003084598.1.80715 WP_003084598.1.80720 WP_003084598.1.80846 WP_003084598.1.80880 WP_003084598.1.80910 WP_003084598.1.80926 WP_003084598.1.80931 WP_003084598.1.80969 WP_003084598.1.81206 WP_003084598.1.81237 WP_003084598.1.81331 WP_003084598.1.81338 WP_003084598.1.81349 WP_003084598.1.81368 WP_003084598.1.81380 WP_003084598.1.8141 WP_003084598.1.81487 WP_003084598.1.81581 WP_003084598.1.81622 WP_003084598.1.81708 WP_003084598.1.81728 WP_003084598.1.81957 WP_003084598.1.81960 WP_003084598.1.82117 WP_003084598.1.82312 WP_003084598.1.82334 WP_003084598.1.8238 WP_003084598.1.82606 WP_003084598.1.82643 WP_003084598.1.82686 WP_003084598.1.82798 WP_003084598.1.82810 WP_003084598.1.83025 WP_003084598.1.83213 WP_003084598.1.83267 WP_003084598.1.83317 WP_003084598.1.83374 WP_003084598.1.8351 WP_003084598.1.8353 WP_003084598.1.83673 WP_003084598.1.83871 WP_003084598.1.83937 WP_003084598.1.84138 WP_003084598.1.84178 WP_003084598.1.84203 WP_003084598.1.84271 WP_003084598.1.84374 WP_003084598.1.84487 WP_003084598.1.84526 WP_003084598.1.84538 WP_003084598.1.84684 WP_003084598.1.84754 WP_003084598.1.84792 WP_003084598.1.84825 WP_003084598.1.84865 WP_003084598.1.84937 WP_003084598.1.85018 WP_003084598.1.85311 WP_003084598.1.85453 WP_003084598.1.85978 WP_003084598.1.86058 WP_003084598.1.86182 WP_003084598.1.86243 WP_003084598.1.86293 WP_003084598.1.86432 WP_003084598.1.8645 WP_003084598.1.86506 WP_003084598.1.86545 WP_003084598.1.86554 WP_003084598.1.86595 WP_003084598.1.86708 WP_003084598.1.86733 WP_003084598.1.86822 WP_003084598.1.8693 WP_003084598.1.87104 WP_003084598.1.87182 WP_003084598.1.8727 WP_003084598.1.87390 WP_003084598.1.87435 WP_003084598.1.87463 WP_003084598.1.87547 WP_003084598.1.8777 WP_003084598.1.87877 WP_003084598.1.87970 WP_003084598.1.87975 WP_003084598.1.88004 WP_003084598.1.88415 WP_003084598.1.88578 WP_003084598.1.88605 WP_003084598.1.88796 WP_003084598.1.889 WP_003084598.1.88949 WP_003084598.1.89234 WP_003084598.1.89266 WP_003084598.1.89330 WP_003084598.1.89434 WP_003084598.1.8949 WP_003084598.1.89523 WP_003084598.1.89610 WP_003084598.1.8976 WP_003084598.1.89776 WP_003084598.1.89868 WP_003084598.1.89871 WP_003084598.1.89886 WP_003084598.1.89992 WP_003084598.1.90024 WP_003084598.1.90272 WP_003084598.1.90770 WP_003084598.1.91012 WP_003084598.1.91236 WP_003084598.1.91281 WP_003084598.1.91431 WP_003084598.1.91467 WP_003084598.1.91527 WP_003084598.1.91585 WP_003084598.1.91796 WP_003084598.1.9182 WP_003084598.1.91860 WP_003084598.1.91862 WP_003084598.1.91882 WP_003084598.1.91938 WP_003084598.1.91943 WP_003084598.1.91996 WP_003084598.1.92043 WP_003084598.1.9219 WP_003084598.1.92321 WP_003084598.1.92357 WP_003084598.1.92594 WP_003084598.1.92624 WP_003084598.1.9272 WP_003084598.1.92759 WP_003084598.1.92769 WP_003084598.1.93001 WP_003084598.1.93122 WP_003084598.1.93130 WP_003084598.1.93196 WP_003084598.1.93250 WP_003084598.1.93493 WP_003084598.1.93498 WP_003084598.1.93520 WP_003084598.1.93797 WP_003084598.1.93848 WP_003084598.1.93897 WP_003084598.1.94031 WP_003084598.1.94065 WP_003084598.1.94218 WP_003084598.1.94221 WP_003084598.1.94230 WP_003084598.1.94285 WP_003084598.1.94288 WP_003084598.1.94349 WP_003084598.1.9444 WP_003084598.1.94732 WP_003084598.1.94742 WP_003084598.1.94818 WP_003084598.1.94856 WP_003084598.1.94881 WP_003084598.1.94896 WP_003084598.1.94897 WP_003084598.1.94943 WP_003084598.1.95018 WP_003084598.1.95056 WP_003084598.1.95132 WP_003084598.1.95207 WP_003084598.1.95305 WP_003084598.1.95324 WP_003084598.1.95354 WP_003084598.1.95460 WP_003084598.1.95959 WP_003084598.1.96041 WP_003084598.1.96357 WP_003084598.1.96434 WP_003084598.1.96667 WP_003084598.1.96863 WP_003084598.1.96880 WP_003084598.1.9706 WP_003084598.1.97204 WP_003084598.1.9722 WP_003084598.1.97271 WP_003084598.1.97272 WP_003084598.1.97377 WP_003084598.1.97461 WP_003084598.1.97488 WP_003084598.1.97499 WP_003084598.1.97503 WP_003084598.1.97521 WP_003084598.1.97583 WP_003084598.1.97784 WP_003084598.1.97826 WP_003084598.1.98111 WP_003084598.1.98276 WP_003084598.1.98308 WP_003084598.1.9845 WP_003084598.1.98522 WP_003084598.1.98718 WP_003084598.1.98907 WP_003084598.1.98963 WP_003084598.1.99068 WP_003084598.1.99103 WP_003084598.1.99214 WP_003084598.1.99293 WP_003084598.1.99443 WP_003084598.1.99461 WP_003084598.1.99647 WP_003084598.1.99757 WP_003084598.1.9989 gi|568151596|ref|YP_008940543.1| gi|564950319|ref|YP_008882889.1| gi|218889156|ref|YP_002438020.1| 557722.PLES_04121 gi|558669828|ref|YP_008806538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]