SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ZAS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A080ZAS7
Domain Number - Region: 85-151
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.0575
Family P-domain of calnexin/calreticulin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A080ZAS7
Sequence length 212
Comment (tr|A0A080ZAS7|A0A080ZAS7_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO63738.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_18623 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSEPERYYTMSQYRDETALAFLYRLNLAAERADLNFRKSSADRERHIKRFIKKLSDDQLK
RTLESQRFRRVSDLEFVLKQQEEVRQKDEPPARQSRDFRADNVVRDHYKPRRQDRAYVAQ
GDEDSGYDEVDERETGVRSAPAVNNPSVSSNSSTPSDSTSEICTPNDTLTREDLIHEVYR
VMDRVGWPQRPPAQRPGGPSQGQSQRPQHRGF
Download sequence
Identical sequences A0A080ZAS7 W2YEA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]