SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081A4R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081A4R1
Domain Number 1 Region: 9-146
Classification Level Classification E-value
Superfamily ENTH/VHS domain 2.36e-32
Family VHS domain 0.0022
Further Details:      
 
Domain Number 2 Region: 149-260
Classification Level Classification E-value
Superfamily GAT-like domain 0.000000000136
Family GAT domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081A4R1
Sequence length 297
Comment (tr|A0A081A4R1|A0A081A4R1_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO73872.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_10213 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAEYAQDVAEVEDLVSRATAEYLAGPEWALNIALCDCANAHHAVCDDIVRFLQRRLQSDN
PKVALLTLVLTETLVKNGPPAIHSQIGSRLFLNQVAALSDGSLGVDVQNQALLLIRQWAD
AFKGSELHAFQDVYRQLKMRGVAFPEIENDVPIFTPPSSASKEENYSGSAPMRRTREQQL
EKLHADLKVVQEKIKLLRDLHNRGQTGEQLEDVLDFLRQCQPRMNTLIEGGIMGKIDERT
LEECLNVNDILMKTLEECSKTKMQDMMTFDSPPGANRTAGLQQDMGELNLNGGGTVL
Download sequence
Identical sequences A0A081A4R1 V9F4G5 W2IZ25 W2WWZ8 W2Z6Y0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]