SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081AJN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081AJN6
Domain Number 1 Region: 2-295
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 1.96e-83
Family Protein prenylyltransferase 0.000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081AJN6
Sequence length 299
Comment (tr|A0A081AJN6|A0A081AJN6_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO79097.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_06136 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MKYSEDPAWTDVVKVPQDDGPDPIVSIAYSADFTDVMDCFRGVLKLNEYSERTLALTLDV
IDVNPANYTVWYFRRRVLEALGSDLREELQFTADMAIQHPKNYQIWHHRREICTMLHDGS
EEKEFCAMAIDGDSKNYHAWAHRQWAVKTFGLWDGELQYVDKMLLEDVRNNSAWNHRWFV
LSNTSGLAATADRQREIDYALDKISIAVHNESPWNYLRGLVRGHEATFAAQVKKKTQEIL
TATPDCIFAAALLVDFYAKEGSEEALEAAIKLVDTLMNDTDRVRKAYWQFRLTTLKRCT
Download sequence
Identical sequences A0A081AJN6 A0A0W8DV33 W2H4Y4 W2XB92 W2ZM54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]