SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081BF54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081BF54
Domain Number 1 Region: 7-161
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 1.96e-50
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000281
Further Details:      
 
Domain Number 2 Region: 179-239
Classification Level Classification E-value
Superfamily PGBD-like 2.75e-17
Family Peptidoglycan binding domain, PGBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081BF54
Sequence length 244
Comment (tr|A0A081BF54|A0A081BF54_9RHIZ) N-acetylmuramoyl-L-alanine amidase {ECO:0000313|EMBL:GAK46672.1} KW=Complete proteome; Reference proteome OX=1333998 OS=Tepidicaulis marinus. GN=M2A_3171 OC=Rhodobiaceae; Tepidicaulis.
Sequence
MSLEITECPSPNHEERRAPIDMLLLHYTGMETGEAARERLCDASAKVSAHYLVEEDGRIL
RLVPEERRAWHAGIASWRGQSDINSCSIGIEIVNGGHDFGYPDFAAPQIAAVEALCLDIL
TRHEIAPARVLGHSDVAPERKADPGEKFPWNRLAKAGIGHWVEPQEIVDGPVLQRGDRGD
TVAELQFQLADYGYGIEVLGVFDAKTEAVVRAFQRHFRQARVDGIADVSTVATLRALRDT
LAGH
Download sequence
Identical sequences A0A081BF54
WP_045449530.1.5436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]