SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081BZW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081BZW2
Domain Number 1 Region: 83-274
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.32e-46
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 5-81
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000034
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081BZW2
Sequence length 283
Comment (tr|A0A081BZW2|A0A081BZW2_9BACT) MCP methyltransferase, CheR-type {ECO:0000313|EMBL:GAK57867.1} KW=Complete proteome; Reference proteome OX=1499967 OS=Candidatus Vecturithrix granuli. GN=U27_04839 OC=Bacteria; Candidatus Vecturithrix.
Sequence
MQFQLTTQIAYTQDDFKLLRDAIYDYSGIYIANDYQGIFMRRLERRIMALAMDSFNEYYY
YLKYNQQHDEEFRNLMDVITIKETYFFRELDQIKTLVNEVIPDLRRAKPSETVKIWSAGC
ATGEEAYTIAMMCIEKGYHRGEARVEIFANDISQEAIQKAKQGVYKQSSFRTTDVSYLQR
FFTAQQDGSYKISDEAKEPLNFFCINLLDKNRLTFLPMFDVIFCRNLIIYFDDNSKRQVI
ETFYKKLNPQRYLFLGHSESLINFTHLFKLRHFQHSLVYQRAT
Download sequence
Identical sequences A0A081BZW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]