SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081FZB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081FZB8
Domain Number 1 Region: 2-226
Classification Level Classification E-value
Superfamily YcfC-like 2.75e-58
Family YcfC-like 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081FZB8
Sequence length 229
Comment (tr|A0A081FZB8|A0A081FZB8_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695} KW=Complete proteome; Reference proteome OX=1232683 OS=Marinobacterium sp. AK27. GN=ADIMK_2000 OC=Oceanospirillaceae; Marinobacterium.
Sequence
MARAHDEQAIALAGVFQAASLVEQIARRGMVAQNSYEASIASLFVSNPKVTEDVFGGVRE
LPFNLSLGLKQMQELVDKRSGGLNPDIMRYALSLIQLERKLNARPDMLDEIGKRLDQIAE
KAKYFAGTHDGEPVQRADGFDPSIYTHSNVIAGIAALYQDTLSTFSIRIQVGGDPRHLQN
SENAARIRALLLAGIRAVILWRQVGGKRWHLFFFRSRVRPSLKKISSAT
Download sequence
Identical sequences A0A081FZB8
WP_036187182.1.10698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]