SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A081HYY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081HYY1
Domain Number 1 Region: 13-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000182
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081HYY1
Sequence length 105
Comment (tr|A0A081HYY1|A0A081HYY1_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:KEF96638.1} KW=Complete proteome OX=1324269 OS=Mycobacterium sp. TKK-01-0059. GN=K883_03678 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MTTPLTLDTARGRDGKLVLVASGEIDLTNVDAFTLALSTAATGSDGAVLVDLSAVEYLDS
AAINALAAHADRIELVAHPILMPVLKVSGLTELTAIVTAPPTEKR
Download sequence
Identical sequences A0A081HYY1 J9WFC1
WP_014941710.1.11749 WP_014941710.1.13459 WP_014941710.1.15143 WP_014941710.1.39679 WP_014941710.1.95202 gi|406030199|ref|YP_006729090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]