SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081LES4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081LES4
Domain Number 1 Region: 10-64
Classification Level Classification E-value
Superfamily Replisome organizer (g39p helicase loader/inhibitor protein) 0.000000471
Family Replisome organizer (g39p helicase loader/inhibitor protein) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081LES4
Sequence length 119
Comment (tr|A0A081LES4|A0A081LES4_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KEP27750.1} KW=Complete proteome OX=1178540 OS=Bacillus zhangzhouensis. GN=BA70_06685 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTKAETLELLKLIKTYFEHFEFDQTKLDAWARILKPENYEKIEANLIVYVKYNQFPPKVA
DLIKAKETRTDRSAAIPNVEETHSYLSEMDKAEPTEEEQEQIERHKAEIRKVLGIGDPS
Download sequence
Identical sequences A0A081LES4
WP_034317508.1.35412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]