SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A081RSK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081RSK4
Domain Number 1 Region: 157-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.62e-74
Family Methylesterase CheB, C-terminal domain 0.0000000557
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 5.83e-28
Family CheY-related 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081RSK4
Sequence length 350
Comment (tr|A0A081RSK4|A0A081RSK4_PHOTE) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1393735 OS=Photorhabdus temperata subsp. temperata Meg1. GN=MEG1DRAFT_03738 OC=Morganellaceae; Photorhabdus.
Sequence
MNKITVLCVDDSALMRQIMREIINSHPDMEVVACAPDPLVARDLIKKHNPQVLTLDVEMP
RMDGIDFLEKLMRLRPMPVVMISSLTAKGSEITLRALELGAVDFVTKPQLGIREGMLAYS
ELIAEKVRTAAQAKLSVQTATPVNSAPLSFKPLLSSEKLIAVGASTGGTEAIKNLLQPLP
VTSPALLITQHMPPGFTRSFAERLNKLSQITVKEAENGERILPGHAYIAPGDRHMELCRN
GADYQVLITDAPAVNRHRPSVDVLFRSVAKFAGRNAVGVLLTGMGNDGAAGLLEMKQAGA
YTLAQDEASCVVFGMPRAAIQMGAVDEVMDILKMSKRMLAKISSGQSVRI
Download sequence
Identical sequences A0A081RSK4 U7QV21
WP_023045505.1.101547 WP_023045505.1.65573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]