SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A081T2A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081T2A0
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000126
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081T2A0
Sequence length 369
Comment (tr|A0A081T2A0|A0A081T2A0_9SPHN) ABC transporter permease {ECO:0000313|EMBL:KER36424.1} KW=Complete proteome OX=1450518 OS=Sphingobium lucknowense F2. GN=AL00_10585 OC=Sphingomonadaceae; Sphingobium.
Sequence
MNKAADLAQEVREGKTVIRLSGNLSIACLHDLPDRLDAIEGPVDTIDLSDVGHMDTIGAW
VLHRAIKRLDCGITGDKCDAERLIATVGSVDEPVNIRPDHEPPWQRVVGQIGEAVINSGT
TLLGLLGFFGGTLVATWNVIRHPGRFRINAVVQRFEVVGVSALGIIGLMSFLIGIVIAQQ
GSVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVDAMR
TIGVSPMEALVLPRTLAVVVMMPLLGFYSSIVAIIGGGFLCAVSLDIPPITFVQRLREVV
PIHDLWVGLIKAPVFGVIIALAGCFQGMQVKANAEEVGLRTTAAVVQAIFLVIVIDAFFA
VFFTWVGWN
Download sequence
Identical sequences A0A081T2A0
WP_025160608.1.2244 WP_025160608.1.58499 WP_025160608.1.6240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]