SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081TS49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081TS49
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily HisI-like 3.27e-45
Family HisI-like 0.00019
Further Details:      
 
Domain Number 2 Region: 111-196
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 5.67e-22
Family HisE-like (PRA-PH) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081TS49
Sequence length 203
Comment (tr|A0A081TS49|A0A081TS49_BACFG) Phosphoribosyl-ATP pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01019} KW=Complete proteome OX=817 OS=Bacteroides fragilis. GN=IB64_21055 OC=Bacteroides.
Sequence
MDLDFDKMNGLVPAIIQDNDTRKVLMLGFMNKEAYEKTVETGKVTFFSRTKNRLWTKGEE
SGNFLNVVSIKEDCDKDTLLIQVNPVGPVCHTGTDTCWGEKNEEPVMFLKLLQDFIDRRH
EEMPENSYTTSLFESGINKIAQKVGEEAVETVIEATNGTDDRLIYEGSDLIYHLIVLLTS
KGYRIEDLARELQIRHSDSWTKH
Download sequence
Identical sequences A0A081TS49
WP_032541030.1.19523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]