SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A083WUF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A083WUF8
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily HisI-like 1.15e-41
Family HisI-like 0.00016
Further Details:      
 
Domain Number 2 Region: 106-193
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 6.73e-21
Family HisE-like (PRA-PH) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A083WUF8
Sequence length 196
Comment (tr|A0A083WUF8|A0A083WUF8_9FLAO) Phosphoribosyl-ATP pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01019} KW=Complete proteome OX=266748 OS=Chryseobacterium antarcticum. GN=HY04_01570 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MNLDFEKGNGLVPVIIQDDRTQQVLMLGYMNEEALELTQKDGRVHFFSRTKNIIWLKGET
SENYLYVKSIKHDCDSDALLIQAKPAGNVCHTGTFSCFEEKNSKGFIYELEETISERIDQ
KVEKSYTYDLYQRGINKMAQKVGEEAVELVIEAKDDNGNLFKDEAADLLYHFLILLKAKS
FSLMDIEEVLMERNRK
Download sequence
Identical sequences A0A083WUF8
WP_034716464.1.79171 WP_034716464.1.7980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]