SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A083XCM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A083XCM6
Domain Number 1 Region: 48-169
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 7.33e-41
Family Insert subdomain of RNA polymerase alpha subunit 0.0000584
Further Details:      
 
Domain Number 2 Region: 8-48,170-221
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 4.06e-26
Family RNA polymerase alpha subunit dimerisation domain 0.0034
Further Details:      
 
Domain Number 3 Region: 247-318
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.11e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A083XCM6
Sequence length 331
Comment (tr|A0A083XCM6|A0A083XCM6_BIFLI) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome OX=1457183 OS=Bifidobacterium longum subsp. infantis EK3. GN=EK3BL_09615 OC=Bifidobacterium.
Sequence
MLIAQRPTLTEESLNPQRSRFTIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSVRISGAL
HEFTTLPGVQEDVTEILLNIKGIVLTSEYDEPVVMYLRKSGKGEAVAGDITPPAGVTIAN
PEQRIATLADDGELEIEFTVERGRGYVPAQMNKQDNDEIGRIPVDSIYSPVLKVSYKVEA
TRVEQRTDFDKLILDVETKPAISPRDAVASAGSTLVELFGLCRELNAQAEGVEVGPAPVA
EETNPEMAVPIEDLNLTQRSYNCLKREGIHTIGELVSHTEQDLLDIRNFGMKSIDEVKEK
LQTLGLSLKSSPMAFDTNNLEGGTFFSPEDE
Download sequence
Identical sequences A0A083XCM6
WP_032745493.1.54911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]