SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A084CHC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084CHC5
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.66e-58
Family Methylesterase CheB, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084CHC5
Sequence length 191
Comment (tr|A0A084CHC5|A0A084CHC5_9PSED) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1495066 OS=Pseudomonas capeferrum. GN=PC358_08690 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNGVRAVVIGASAGGVAALFEVLGALPPAFSLPVLCVLHLPDDRHSQLAEVLQRRLHRPV
REACDKERISAGQVYVAGPSYHLSVEHDLTLSLSQEAPVHFSRPAIDFLFISAADAYGDG
LLGVLLTGANEDGAKGLAYIKNNGGRTIVQDPRDAQVALMPEAALALHQPDHILTLSGIG
QLLATLETRAC
Download sequence
Identical sequences A0A084CHC5 A0A099EC19
WP_033698842.1.25404 WP_033698842.1.75421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]