SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A084E998 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084E998
Domain Number 1 Region: 9-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.79e-52
Family Methylesterase CheB, C-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 275-467
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.83e-47
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0004
Further Details:      
 
Domain Number 3 Region: 209-277
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000379
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0056
Further Details:      
 
Domain Number 4 Region: 812-938
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000314
Family Flavin-binding PAS domain 0.079
Further Details:      
 
Domain Number 5 Region: 692-813
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000145
Family BphP N-terminal domain-like 0.044
Further Details:      
 
Domain Number 6 Region: 1019-1132
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000114
Family Histidine kinase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084E998
Sequence length 1139
Comment (tr|A0A084E998|A0A084E998_SPHYA) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=13690 OS=Sphingobium yanoikuyae (Sphingomonas yanoikuyae). GN=CP98_04785 OC=Sphingomonadaceae; Sphingobium.
Sequence
MSSENVPSPRLPVIGIGASAGGLEALREMLSTARGPTGMAFVIVQHLDPTHESMMAQLLD
RHTTLEVLQSEGGEKIAADKVYIIPPGHGLAIRDGVLELTEFAQPRGLRRPIDDFFISLA
TDQQGDAACVILSGTGADGTTGLRAIKENGGVCLVQQPESARYDGMPLSAVGTGLVDYVK
SPGDMVDCLIAFFNHRAIDAAEREAALVADHVDEMCKTLRAAVGHDFSGYKRTTLIRRVE
RRMHVLGIGSGSTYLARIKSDAEECEALFRDLLINVTRFFRDAELFERLRTQVVEPLMRE
SDGEEIRIWVSGCSSGEEAYSIAILFAEAARKLGVTPATVQIFATDIDESMLQIAREGVY
PASALGDLPIALREHYAIPHAERFTIASQIRDMIRFSNHSIVKDPPFSRIDLVSCRNLLI
YFDDRLQQSVMPLLHYAIRPGGYLFLGPSESVGRFEHLFPTLDQYGRLFKRAPGPPSYPI
DLPGSAYPRGTRPDGRTERGSGRTLSDEGAAVRRIVDRYAPASLVLDQDGGIIAAYGRLG
RYFDFPVTRTGGSSAISLARAGLRTVLGPLLREGRDTRKRVVVRDVQVETEYGNQQIDVV
CDPLPDGMLLFVFRDTAPFRPVLEDDMAEMDAGDDHLDALEDELRVTRHRLRSTVEELET
ANEELKSSNEEMMSMNEELQSTNEELSTVNDELKSKVDQLTVANSDLRNFFESTELAVVV
LDSDLRIRSFTEAATSLFPLQPGDRGRPLEDVSTRLVEADYMDDARAVAAGHAAIQRRVT
TRDGERCLSLRTLPYRLQNGATDGATLVLTDITEALSMERDLAAQRERLDMAIRAGGIAV
WEYDVETREAVVDAHGREILGISLETASTDVETRLGRMHPDDRPGFEAALAKVIADGGDF
EASYRVVLREETRRIKSFGRLVVGEGSPRLVGVSIDVTPEYALAETRELMLREMNHRVKN
LFAIVAGMISAGSRSHQDVRAFAADMRERIAALGNAHSLASPTGEVQAIDLADLIEATLA
PYRAHADIAVDGPHVRIVRSCLSPLALMLHEWATNAVKYGALSPDGGVLRIGWALENDIL
RLRWAETFSHEASLSEGTGFGTVLVKTSAKQLGAELTRGMKDGTFTIELCLPSARLLDG
Download sequence
Identical sequences A0A084E998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]