SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084IXI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A084IXI6
Domain Number - Region: 25-81
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00314
Family Ribosomal protein L11, C-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084IXI6
Sequence length 108
Comment (tr|A0A084IXI6|A0A084IXI6_BACMY) Putative phosphoribosyl-ATP pyrophosphohydrolase {ECO:0000313|EMBL:AJH19632.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=B7492_05140 OC=Bacillus cereus group.
Sequence
MSTYNRLVRDRVPEKILMSGKTYTAQKLTGQAYIQALAKIGTEEIREFASMKEREHALDS
LADALEIIISLARAEGATMEDVELIRKQKEEERGGFTRGIYLMDVSEE
Download sequence
Identical sequences A0A084IXI6 A0A150C2V3 A0A1I6C0B8 A9VGK2 J8EE79 J8EWW2 J8PBY8 J8PMM3 J9CCV7 R8CRK6 R8DC37 R8EXW4 R8HQM5 W4E495
gi|163938792|ref|YP_001643676.1| WP_002125566.1.10033 WP_002125566.1.100646 WP_002125566.1.100649 WP_002125566.1.11324 WP_002125566.1.17940 WP_002125566.1.20051 WP_002125566.1.20881 WP_002125566.1.27729 WP_002125566.1.27732 WP_002125566.1.28299 WP_002125566.1.2902 WP_002125566.1.30061 WP_002125566.1.35095 WP_002125566.1.36226 WP_002125566.1.37635 WP_002125566.1.39317 WP_002125566.1.39896 WP_002125566.1.4354 WP_002125566.1.4496 WP_002125566.1.45835 WP_002125566.1.46157 WP_002125566.1.47674 WP_002125566.1.47957 WP_002125566.1.50411 WP_002125566.1.54007 WP_002125566.1.57105 WP_002125566.1.59016 WP_002125566.1.63476 WP_002125566.1.6426 WP_002125566.1.68186 WP_002125566.1.68668 WP_002125566.1.72867 WP_002125566.1.75292 WP_002125566.1.76817 WP_002125566.1.79293 WP_002125566.1.82832 WP_002125566.1.85187 WP_002125566.1.86789 WP_002125566.1.87416 WP_002125566.1.99558 WP_002125566.1.99908 315730.BcerKBAB4_0788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]