SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084JPT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084JPT8
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily PTS IIb component 3.53e-49
Family PTS IIb component 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084JPT8
Sequence length 157
Comment (tr|A0A084JPT8|A0A084JPT8_9FIRM) PTS mannose transporter subunit IIAB {ECO:0000313|EMBL:KEZ90972.1} KW=Complete proteome; Reference proteome OX=29354 OS=[Clostridium] celerecrescens. GN=IO98_06240 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MAIVHARVDERLIHGQVAMVWTNTVGASRIIVVNDEAVKDELIIAGLKMAKPAGVKLSIL
SLKRAAEKFAEKAYEEDKVFLITKNVTDMATLIRSEVPIKAFNVGNVAKREGSRPIKKSV
NLTEDDEKDIREMIQLGVSVTAQMLPNESDQSIVNML
Download sequence
Identical sequences A0A084JPT8 A0A0U5P673
WP_038279089.1.26132 WP_038279089.1.85205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]