SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A084QW95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084QW95
Domain Number 1 Region: 685-909
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.73e-64
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00094
Further Details:      
 
Domain Number 2 Region: 911-1071
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.7e-36
Family NADPH-cytochrome p450 reductase-like 0.00086
Further Details:      
 
Domain Number 3 Region: 280-439
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.23e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0019
Further Details:      
 
Domain Number 4 Region: 427-671
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084QW95
Sequence length 1071
Comment (tr|A0A084QW95|A0A084QW95_STAC4) Uncharacterized protein {ECO:0000313|EMBL:KFA68230.1} KW=Complete proteome; Reference proteome OX=1283841 OS=Stachybotrys chlorohalonata (strain IBT 40285). GN=S40285_01599 OC=Stachybotrys.
Sequence
MANTQESGGGAAADFVTTIKPTFTKKSSSLPFGQSVPLASISGPTYVTAQLLVQHIAYKL
SDKVYAYSPDTFDLDVAARQWAASGEKNIHGYAPSVLQSQTRTGAGAVALGYIFSPDFDV
SKRHIPQTLIASSGSLHQLRGTLDQLSLLYGVSSPVVAHIASTDYSASNGLVSNFDTAMR
IAEDLGLGLVSSSSTYEAQHMSIFSTLLASVVPTIHIYDGIRVARETLRVVDALSENGVA
DVYNKLSLEANQLNKRLDDAGKVLELLKLFNDELGTLYQPFEYHGHQSPDVVLVAFGSVE
TQVAKQVVSRISADGAKVGVINVRVYRPFIEEEFLKAIPASTRTIAVLGQVSDEPAVADE
AVQSALYGDVLTAVTFADAFEEEPDVLDIKYTPSQFLTPQGLVNTLHDIFGNEGEAKKLP
SLIQADQYTFWDVDDSAALASPSVIGDVLSKQSTVNVYVHETLDNLTQGGVIRTDIRASK
KALEAPYPITEAEVVVVGDERILQEVDVVKGTAANGKIILKLTNFKDDQVEKRLPVSFRK
GVQEKKIELFILDISYSPAFERDPAVTQLLTELSFLRVSRPDISPEDISKLDLVQGQSQT
VDECVDAVVKCLRQLEVPASWAEVEAGYVDPQLPATIQPNSFVSFQKEEAEPKYDIDDWQ
VAAKGLAFKEAYSTRSSLRPELAVKTATITVKENRRLTPADYDRNIFHIEFDLGDSGLTY
KIGEALGIHAENDEEQVNEFIEYYGLNPASLVQVPSREDNAVTEVRTVYQALMQNVDLLG
KPPKRFYEGLAEFATDPEEKKLLEKLAGPAGAAELKKRTDVDTVTYVDILKEFGSARPSF
SELVKIVSPAKRREYSIASAQAVTPTSVALMIVVVDWVDSKGRNRFGHATRYLSRLAPGA
KVTASVKPSVMKLPTKDTAPLIMAGLGTGLAPFRAFVQYRAMQKAQGKEIGAILLYLGSR
HQREEYLYGEEWEAYLAAGVVTLIGSAFSRDQPQKIYIQDRMRQTLNDIVKAYIKEEGSF
YLCGPTWPVPDVTQVLMEAIATDAKANGKKVDPKKEIEKLKEEGRYVLEVY
Download sequence
Identical sequences A0A084QW95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]