SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084RLV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084RLV3
Domain Number 1 Region: 40-108
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000000000000119
Family F1F0 ATP synthase subunit C 0.0038
Further Details:      
 
Domain Number 2 Region: 123-191
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000000000915
Family F1F0 ATP synthase subunit C 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084RLV3
Sequence length 201
Comment (tr|A0A084RLV3|A0A084RLV3_STACH) Uncharacterized protein {ECO:0000313|EMBL:KFA77188.1} KW=Complete proteome; Reference proteome OX=1283842 OS=Stachybotrys chartarum IBT 40288. GN=S40288_04598 OC=Stachybotrys.
Sequence
MSLTYGVGGTVSFLTLVGAYMLFTGDGEAFNVGAFLEAVSPYTWASMGIAMCIGLSVVGA
AWGIFITGSSILGGGVKAPRIRTKNLISIIFCEVVAIYGVIMAIVFSAKVNSVAGPAMYS
AESYYTGYALFWSGITVGMCNLVCGVSVGINGSGAALADAADGTLFVRILVIEIFSSILG
LFGLIVGLLMSSSAGEFGKNS
Download sequence
Identical sequences A0A084B052 A0A084RLV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]