SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A084RW79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084RW79
Domain Number 1 Region: 334-520
Classification Level Classification E-value
Superfamily MIR domain 1.31e-60
Family MIR domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A084RW79
Sequence length 742
Comment (tr|A0A084RW79|A0A084RW79_STACH) Uncharacterized protein {ECO:0000313|EMBL:KFA80464.1} KW=Complete proteome; Reference proteome OX=1283842 OS=Stachybotrys chartarum IBT 40288. GN=S40288_02089 OC=Stachybotrys.
Sequence
MSADAAAVASGANVGDGLRRRPVAPSQGAPGVVQAQPEDNKKLVKKEPSFLEVLDEWEFI
IAPVIFTLLAIFTRLYKIGISNIVTWDEAHFGKFGSYYIKHEYYFDVHPPLGKMLVGLSG
VLAGYNGSFEFKSGEKYPEEVNYAFMRIFNAFFGIVCIPLAYYTARELKLTRPAVWLVTL
MVLCENSYTTISRFILLDSMLLCGTVATVFCWSKFHNQRYSSFEPEWFFWLFMTGISIGC
VCSVKLVGLFVTALVGLYTIEDLWRKFGDTRMPIPTLGAHLLARIVGLIIIPFLIYLLSF
ALHFAILDRSGPGDAQMSSLFQANLRGTEVGKNSPLEIALGSRATIKNMGYGGGLLHSHV
QTYPEGSQQQQITCYHHKDSNNDWFFYPNRREMPYDAADEELRFIGDGSTIRLIHAQTGR
NLHSHEIAAPVTKVDKEVSCYGNVTVGDEKDHWKVEVVRDAASRDRSRIRTLTTAFRLKH
EVLGCYLRAGNKNLPQWGFKQIEVTCTKENNPRDSYTHWNVEAHWNDKLPIGDPSVYKSP
FFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILHVGLRMCGWDDNIVKYFLLGN
PIVYWGSTASLVIVALVIVFYLVRWQRGFDDLTPKDIDQIHYSALYPIAGWFLHYLPFVI
MARVTYVHHYYPALYFAILTFGFLVDWTVRNRNSVVQGAVYGFLYTIIIGLYIVFIPICW
GMIGPNKQYSYMKWFDTWRMSD
Download sequence
Identical sequences A0A084RW79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]