SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A084T610 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084T610
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084T610
Sequence length 99
Comment (tr|A0A084T610|A0A084T610_9VIBR) NTP-binding protein {ECO:0000313|EMBL:KFA96145.1} KW=Complete proteome OX=1517681 OS=Vibrio sp. ER1A. GN=HW45_19415 OC=Vibrionaceae; Vibrio.
Sequence
MDTKLVVRNEGVLELIGNVDRDTVPELWNTIQSVNFDEPEMELALDKVKRFDSAGLVMLI
HLLEHAKNRKCHIMLSFVPDELKILFQLYNVESVIEKHI
Download sequence
Identical sequences A0A084T610 A6D4D8
WP_006073306.1.30620 WP_006073306.1.83143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]