SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084TCC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084TCC7
Domain Number 1 Region: 78-271
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.01e-49
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0000415
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 7.45e-17
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A084TCC7
Sequence length 274
Comment (tr|A0A084TCC7|A0A084TCC7_9VIBR) Chemotaxis protein methyltransferase {ECO:0000256|PIRNR:PIRNR000410} KW=Complete proteome OX=1517681 OS=Vibrio sp. ER1A. GN=HW45_13565 OC=Vibrionaceae; Vibrio.
Sequence
MLVNTQFGYTEHDFEAIASLIYCRVGIAFRKNKRNLVYNRLVGRLRVHRLVNFTQYLKLL
DDQNHEEWEYFVNALTTNLTYFFREPYHFDFLKSYVQEHFEHLTTSEPLRIWCSACSTGE
EAYSIAMTMVEAFGTNQPPVKILATDLNTHVLSVAREGNYTTDKLERVSEQQKLQHFIYH
KYKNTYEIRPEVKSLVHFKCLNLMDTQWPMKKSFNMIFCRNVMIYFDRETQSRLLTKFAH
YLPQGSLLFLGHSESFSEPQDKFKPLRQTMYTRV
Download sequence
Identical sequences A0A084TCC7
WP_038227344.1.30620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]