SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A084U7Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084U7Z8
Domain Number 1 Region: 721-960
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.41e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0031
Further Details:      
 
Domain Number 2 Region: 17-196
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000518
Family Pyruvate oxidase and decarboxylase Pyr module 0.049
Further Details:      
 
Domain Number 3 Region: 431-617
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000369
Family Pyruvate oxidase and decarboxylase PP module 0.052
Further Details:      
 
Domain Number 4 Region: 275-389
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000147
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084U7Z8
Sequence length 1158
Comment (tr|A0A084U7Z8|A0A084U7Z8_9RHIZ) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KFB09084.1} KW=Complete proteome; Reference proteome OX=472175 OS=Nitratireductor basaltis. GN=EL18_00098 OC=Phyllobacteriaceae; Nitratireductor.
Sequence
MTLHDVSLDDKYDLTKERIYVSGSQAVIRMLLMQRERDRQAGLNTAGFVSGYRGSPLGGF
DQQLWKARKELGERDVVFQPGLNEELAATACWGSQQSELLGEGKYDGVFALWYGKGPGVD
RTGDVFRHANASGSSRHGGVLALMGDDHTAESSTVANSSEFAFVDAMVPILNPAGVQELI
DYGLYGYALSRFAGTWTAIKCVKDNIESTASVDVAMERLNIVLPEIDMPEGGLNIRHEVN
MLGQEQRLHDFKREAAAAFITANGLNRMVYTGGRNPKIGIITLGTSFLDVRQALDELGID
EERANTIGLRLFKVAAPWPFDYQHMAQFIQGLDMVIVVEEKRSLVEVQLRENLYGTATQP
IIIGKKDDRDERLFSPMGSLDINHIAITIGERILKHIGHSEEIAARVSKLRQFQAMLADT
QDVALRRPHFCSGCPHNTSTNLPEGSIAGGGIGCHFMALWMERGTVGFTAMGGEGAQFIG
QAPFTKREHFFQNLGDGTYNHSGSLALRAAVAAGLNVTYKILYNDAVAMTGGQPHEGGLT
VDMIAAQVRAEGVKRIAVVSDEPEKYEGKISFPAGSTIHHRDDLDQVQRELREEKGVTVL
LYDQTCAAEKRRRRKRGTFPDPDKRVIINELVCEGCGDCGVKSNCVSVQPVETEFGRKRM
IDQSSCNKDFSCVNGFCPSFVTVHGGKLKKVKGDTNGSDPLDGVPPAKIMPLGVGGWAGV
VDGIGGTGVVTIGAILGMAAHMEGKGAGIIDMAGLAQKGGAVFSHLKIAETPADVHSIRV
PAGKADLVLGCDLVVSGARKVLAAVRHDHTLFVANTAEVMPGDFARSADFSLPVERLKKA
VREAAGEGHAHFFDATRTATVLLGNSIGANMFMLGMAYQLGGIPVSDEAIEKAIHLNGQA
VSMNIAAFRWGRRAAHDPEHVRKLVADAAPAAGREIATSLEDIIARRVNFLTDYQDAAYA
ERYRQRIEQLRQAEDRAVPGSTRVTEHAARNLFKLMAIKDEYEVARLYTDGSFRKQLEGA
FESYESLEFHLAPPLLAKRDENGHLKKARYGQWMMKAFGLLARFRKLRGTALDPFGHTDE
RKMERRLLAEYEADLDLIEREISASRLDAAAALAAVPELVRGYGHVKEAHVERAQAERTR
LLERLKQNDPDPVLHAAE
Download sequence
Identical sequences A0A084U7Z8
WP_036483522.1.6927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]