SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A084YZH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084YZH6
Domain Number 1 Region: 444-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000157
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084YZH6
Sequence length 567
Comment (tr|A0A084YZH6|A0A084YZH6_9GAMM) Sulfate permease {ECO:0000313|EMBL:KFB90620.1} KW=Complete proteome OX=82995 OS=Serratia grimesii. GN=CR62_02375 OC=Yersiniaceae; Serratia.
Sequence
MQWKSLQALTPGLTHLLGYQRSWLKPDIRAGLSVAAVALPVAIAYAELAGVSPVVGLYSC
ILPMVAYAFFGSSRQLIVGPDAATCAVIAAVVTPLAAGNMERHWQLTIMMTAMMGAWCLL
ASRFKLGALADLLSRPILSGLLNGVAITIIVDQIGKVFGFGVHPAQLIERIYALPGNLMH
SDWLTMAVSLLTLVTLIGFKKWRPNWPAPLFAIVLVTFVTWVGGLQQHGVVTVGGFSDVL
PIVQWPDFQPGLLRDMVIPALNLAVVSFVSMMLTARSFAAKNGYEVNADAEFRALGLVNI
VSALSQGFAISGADSRTAVNDANGGKSQLVSIIAAAVIAFVLLFLMAPLQFIPVAGLGVV
LMYAACSLLDIRGIWVMRRRNAQAFRLAMFTFLCVLLVGVISGIGLAVLLGLMQFLRTVF
RPTEQLLGVNDEGMIHSMGNNNGIKVVPGVMMYRFNSPLTYFNVAYFKRRILNLVDSTPF
QPRWVVVDAVASFTHADISVLAAIDELKRDLLQRNVKLVLAGRRTELTRWFRINRLGRDR
ELILVPDLYLALKLIQSKEQAEPPAAQ
Download sequence
Identical sequences A0A084YZH6
WP_037415871.1.16061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]