SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085D397 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085D397
Domain Number 1 Region: 46-97
Classification Level Classification E-value
Superfamily TrpR-like 0.0000204
Family SPO1678-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085D397
Sequence length 133
Comment (tr|A0A085D397|A0A085D397_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KFC41442.1} KW=Complete proteome; Reference proteome OX=1485007 OS=Halomonas sp. SUBG004. GN=DK37_30645 OC=Halomonadaceae; Halomonas.
Sequence
VKALSIQALKKKSVQDLEREVKRLKKQLKRAQLENDILKKGGRVLHQTRQVKFAFIEAHR
DQRWPLVIVCEVLGVSRSGYYRWRERQQQHGPQQVRHQALTAFLLQCARLQHGVPGYRKL
WREAQDAGFCCGQ
Download sequence
Identical sequences A0A085D397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]