SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085EX85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085EX85
Domain Number 1 Region: 150-337
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.97e-58
Family Methylesterase CheB, C-terminal domain 0.0000446
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily CheY-like 3.27e-20
Family CheY-related 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085EX85
Sequence length 339
Comment (tr|A0A085EX85|A0A085EX85_9BRAD) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1502851 OS=Bosea sp. LC85. GN=FG93_05337 OC=Bradyrhizobiaceae; Bosea.
Sequence
MRIGLVNDLPMAVELLRRIVVSTTEHAVAWIAVNGREAVEACRHDRPDLILMDLNMPEMD
GVTATQRIMAATPCPILLVTASVDANVSGVYEAMGHGALDAVDIPTVGADGNASAQSAAL
LARIAMIGRLSRDVAPVTRTQAPARTAASSAQQLIAIGASAGGPAAVASLLGGLPRGFPA
ALVLVQHLDAHFVPGFASWLGQHTALSVRAAIEGDRPEPGTVLIAASGDHLVFKSGNDLG
YRAEPRDYVYRPSVDVFFESVAQWWQGDLVGVLLTGMGRDGARGLKLLRDRKHLTLAQDR
ATSAVYGMPKAAAAIDAASEILPLAAIAPRLVEACRRSF
Download sequence
Identical sequences A0A085EX85
WP_043240710.1.44845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]