SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085F5J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085F5J0
Domain Number 1 Region: 180-369
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.4e-54
Family Methylesterase CheB, C-terminal domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 16-131
Classification Level Classification E-value
Superfamily CheY-like 1.71e-24
Family CheY-related 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085F5J0
Sequence length 373
Comment (tr|A0A085F5J0|A0A085F5J0_9BRAD) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1502851 OS=Bosea sp. LC85. GN=FG93_04214 OC=Bradyrhizobiaceae; Bosea.
Sequence
MVSPRSSSHGRTAIRPKTVVIADDSVVVRGLFARWLGESGQFHVVAVAGDGEMAVEHATR
YRPDIMVLDLDMPGLDGLAALPQIVRESPKTAILLATTLTERNARLALQGMTMGAMDVLP
KPESRAGMTLSLDFRSEFLTKLGSIAQSSHEALLPFSEVPPEPGLPSGITDLRPLISMMP
RYLVIGASTGGPRAVAKVLTDIGEGLQDLTTLVVQHMPPLFTASFAEQLSGQIGVRAREP
FDGERLSRGTVYIAPGGRHLGIDRRLGHIVASIGDGPPVRFCRPAVDVLFSEAANHLGPA
ALGLVMTGMGSDGTDGAGALRRAGAAVIAQDEMSSTIWGMPGSVVRARHASTVVALDGIG
PAIRALVRGGYPA
Download sequence
Identical sequences A0A085F5J0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]