SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085GEI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085GEI4
Domain Number 1 Region: 794-1168
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.82e-119
Family PFOR PP module 0.0000000207
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-74
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000116
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.71e-73
Family PFOR Pyr module 0.0000000776
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.11e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000248
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.39e-23
Family Ferredoxin domains from multidomain proteins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085GEI4
Sequence length 1176
Comment (tr|A0A085GEI4|A0A085GEI4_9ENTR) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome; Reference proteome OX=1006004 OS=Buttiauxella agrestis ATCC 33320. GN=GBAG_1845 OC=Enterobacteriaceae; Buttiauxella.
Sequence
MITTDGNGAVASVAFRASEVIAIYPITPSSTMAELADAWSGDGRKNVWGDTPRVVEMQSE
AGAIAAVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGQLTPFVLHVAARTVATHALSIF
GDHSDVMAIRQTGCAMLCASSVQEAQDFALISHIATLKSRVPFIHFFDGFRTSHEINKIV
PLADSTLLELLPQKEIDEHRARALNPEHPVIRGTSANPDTYFQSREASNLWYDAVYQHVE
QAMDSFAAATGRQYRPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
FRPFSADHLLEVLPESARQIAVLDRTKEPGALAEPLYLDVMTSLAEAFNRGDRETLPRVI
GGRYGLSSKEFGPDCVLAVFNELTQTKPRPRFTVGIYDDVTNLSLPLPENTLPNRAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPFYTQGYFVYDSKKAGGLTVSHLRVSEQPINSTYL
IDKADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYGADEVWHRLPQEVQAVLNQKKARF
FVVNAAKIARECQLGARINTVMQMAFFHLTHILPGDSALAELQGAIAKSYSSKGQELVER
NWQALALARESLAEVTLQEVNETSPMRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTQWEKRNIAEEIPIWKPDICTQCNHCVAACPHSAIRAKVVQPEEMENAPAA
LQSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KENYDFFLQLPEMDRTSLERIDIRTSQLLQPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDGNGRGPAWANSLFEDNAEFGLGFRLTVDQHRARVMRL
VDKFADQLPAELNEQLHTEATPEVRREQVIELRKHLANIDDPDARQLLTDADAMVDKSIW
LIGGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGK
RKARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDL
ALSHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSDALADTLMKEQRFRRLNAQ
QPEVAEQLWKDAAVDLQKRYDFLAQMAGKAEKTDSE
Download sequence
Identical sequences A0A085GEI4
WP_034495229.1.84142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]